Ecoer Logo
VOTING POWER100.00%
DOWNVOTE POWER100.00%
RESOURCE CREDITS100.00%
REPUTATION PROGRESS5.26%
Net Worth
0.000USD
STEEM
0.003STEEM
SBD
0.000SBD
Effective Power
1.201SP
├── Own SP
0.000SP
└── Incoming Deleg
+1.201SP

Detailed Balance

STEEM
balance
0.003STEEM
market_balance
0.000STEEM
savings_balance
0.000STEEM
reward_steem_balance
0.000STEEM
STEEM POWER
Own SP
0.000SP
Delegated Out
0.000SP
Delegation In
1.201SP
Effective Power
1.201SP
Reward SP (pending)
0.000SP
SBD
sbd_balance
0.000SBD
sbd_conversions
0.000SBD
sbd_market_balance
0.000SBD
savings_sbd_balance
0.000SBD
reward_sbd_balance
0.000SBD
{
  "balance": "0.003 STEEM",
  "savings_balance": "0.000 STEEM",
  "reward_steem_balance": "0.000 STEEM",
  "vesting_shares": "0.000000 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "1953.311140 VESTS",
  "sbd_balance": "0.000 SBD",
  "savings_sbd_balance": "0.000 SBD",
  "reward_sbd_balance": "0.000 SBD",
  "conversions": []
}

Account Info

nametotalrehash
id1304835
rank1,514,868
reputation6075989776
created2019-08-07T19:49:24
recovery_accountsteem
proxyNone
post_count72
comment_count0
lifetime_vote_count0
witnesses_voted_for0
last_post2019-09-22T19:29:36
last_root_post2019-09-22T19:29:36
last_vote_time2019-09-22T19:35:03
proxied_vsf_votes0, 0, 0, 0
can_vote1
voting_power0
delayed_votes0
balance0.003 STEEM
savings_balance0.000 STEEM
sbd_balance0.000 SBD
savings_sbd_balance0.000 SBD
vesting_shares0.000000 VESTS
delegated_vesting_shares0.000000 VESTS
received_vesting_shares1953.311140 VESTS
reward_vesting_balance0.000000 VESTS
vesting_balance0.000 STEEM
vesting_withdraw_rate0.000000 VESTS
next_vesting_withdrawal1969-12-31T23:59:59
withdrawn0
to_withdraw0
withdraw_routes0
savings_withdraw_requests0
last_account_recovery1970-01-01T00:00:00
reset_accountnull
last_owner_update1970-01-01T00:00:00
last_account_update2019-08-13T00:55:54
minedNo
sbd_seconds0
sbd_last_interest_payment1970-01-01T00:00:00
savings_sbd_last_interest_payment1970-01-01T00:00:00
{
  "id": 1304835,
  "name": "totalrehash",
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM7AF3829Weqe6kmQA38ZybvratQSF1F4uWxU18i3wWk8HEqQBX3",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8XCAWpp3Vz8GwsnM2WzPTwxaMqG8TdVGRcMpkMBhdwJKC23z5r",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM5cqV9FuVStYBmeGtjdofyjopdbeimMSVrTJ6K5K3Jw3ivdrNAk",
        1
      ]
    ]
  },
  "memo_key": "STM7JkprcGqAcrXgZE8gaKYVgbJ36aN47a1rTEx2N4noMCmTxkQEf",
  "json_metadata": "{\"profile\":{\"profile_image\":\"https://cdn.steemitimages.com/DQmNT6TKB7zV8o6XeQvZWewGWYGgbnNNUBRYUMfzrT1MviJ/75HdOEyZ_400x400.jpg\"}}",
  "posting_json_metadata": "{\"profile\":{\"profile_image\":\"https://cdn.steemitimages.com/DQmNT6TKB7zV8o6XeQvZWewGWYGgbnNNUBRYUMfzrT1MviJ/75HdOEyZ_400x400.jpg\"}}",
  "proxy": "",
  "last_owner_update": "1970-01-01T00:00:00",
  "last_account_update": "2019-08-13T00:55:54",
  "created": "2019-08-07T19:49:24",
  "mined": false,
  "recovery_account": "steem",
  "last_account_recovery": "1970-01-01T00:00:00",
  "reset_account": "null",
  "comment_count": 0,
  "lifetime_vote_count": 0,
  "post_count": 72,
  "can_vote": true,
  "voting_manabar": {
    "current_mana": 1953311140,
    "last_update_time": 1588956645
  },
  "downvote_manabar": {
    "current_mana": 488327785,
    "last_update_time": 1588956645
  },
  "voting_power": 0,
  "balance": "0.003 STEEM",
  "savings_balance": "0.000 STEEM",
  "sbd_balance": "0.000 SBD",
  "sbd_seconds": "0",
  "sbd_seconds_last_update": "1970-01-01T00:00:00",
  "sbd_last_interest_payment": "1970-01-01T00:00:00",
  "savings_sbd_balance": "0.000 SBD",
  "savings_sbd_seconds": "0",
  "savings_sbd_seconds_last_update": "1970-01-01T00:00:00",
  "savings_sbd_last_interest_payment": "1970-01-01T00:00:00",
  "savings_withdraw_requests": 0,
  "reward_sbd_balance": "0.000 SBD",
  "reward_steem_balance": "0.000 STEEM",
  "reward_vesting_balance": "0.000000 VESTS",
  "reward_vesting_steem": "0.000 STEEM",
  "vesting_shares": "0.000000 VESTS",
  "delegated_vesting_shares": "0.000000 VESTS",
  "received_vesting_shares": "1953.311140 VESTS",
  "vesting_withdraw_rate": "0.000000 VESTS",
  "next_vesting_withdrawal": "1969-12-31T23:59:59",
  "withdrawn": 0,
  "to_withdraw": 0,
  "withdraw_routes": 0,
  "curation_rewards": 0,
  "posting_rewards": 0,
  "proxied_vsf_votes": [
    0,
    0,
    0,
    0
  ],
  "witnesses_voted_for": 0,
  "last_post": "2019-09-22T19:29:36",
  "last_root_post": "2019-09-22T19:29:36",
  "last_vote_time": "2019-09-22T19:35:03",
  "post_bandwidth": 0,
  "pending_claimed_accounts": 0,
  "vesting_balance": "0.000 STEEM",
  "reputation": "6075989776",
  "transfer_history": [],
  "market_history": [],
  "post_history": [],
  "vote_history": [],
  "other_history": [],
  "witness_votes": [],
  "tags_usage": [],
  "guest_bloggers": [],
  "rank": 1514868
}

Withdraw Routes

IncomingOutgoing
Empty
Empty
{
  "incoming": [],
  "outgoing": []
}
From Date
To Date
steemdelegated 1.201 SP to @totalrehash
2020/05/08 16:50:45
delegatorsteem
delegateetotalrehash
vesting shares1953.311140 VESTS
Transaction InfoBlock #43201927/Trx 12a9f122ad4a356e4e756a3e68793911652e0367
View Raw JSON Data
{
  "trx_id": "12a9f122ad4a356e4e756a3e68793911652e0367",
  "block": 43201927,
  "trx_in_block": 3,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2020-05-08T16:50:45",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "totalrehash",
      "vesting_shares": "1953.311140 VESTS"
    }
  ]
}
steemdelegated 6.051 SP to @totalrehash
2019/12/22 21:12:15
delegatorsteem
delegateetotalrehash
vesting shares9842.019625 VESTS
Transaction InfoBlock #39270246/Trx 8a801078e01fc34b91e0d30cff19a92a38966c76
View Raw JSON Data
{
  "trx_id": "8a801078e01fc34b91e0d30cff19a92a38966c76",
  "block": 39270246,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-12-22T21:12:15",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "totalrehash",
      "vesting_shares": "9842.019625 VESTS"
    }
  ]
}
steemdelegated 18.182 SP to @totalrehash
2019/11/26 10:55:42
delegatorsteem
delegateetotalrehash
vesting shares29572.801513 VESTS
Transaction InfoBlock #38510512/Trx 3394de166c802ce0e9dc40bee47bab1c3493c1be
View Raw JSON Data
{
  "trx_id": "3394de166c802ce0e9dc40bee47bab1c3493c1be",
  "block": 38510512,
  "trx_in_block": 13,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-11-26T10:55:42",
  "op": [
    "delegate_vesting_shares",
    {
      "delegator": "steem",
      "delegatee": "totalrehash",
      "vesting_shares": "29572.801513 VESTS"
    }
  ]
}
2019/09/23 18:20:21
parent authortotalrehash
parent permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
authorsteemcleaners
permlinkre-totalrehash-thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp-20190923t182020804z
title
body[Source](https://www.theburningplatform.com/2019/09/18/the-bolsheviks-even-want-to-tax-your-toaster-oven/) [Plagiarism](http://www.plagiarism.org/plagiarism-101/what-is-plagiarism/) is the copying & pasting of others work without giving credit to the original author or artist. Plagiarized posts are considered spam. Spam is discouraged by the community, and may result in action from the [cheetah bot](https://steemit.com/faq.html#What_is__cheetah). [More information and tips on sharing content.](https://steemcleaners.org/copy-paste-plagiarism/) If you believe this comment is in error, please contact us in [#disputes on Discord](https://discord.gg/YR2Wy5A)
json metadata{"app":"steemcleaners/0.3","format":"markdown+html","community":"steemcleaners"}
Transaction InfoBlock #36679853/Trx 0fcf2f7dc5e4ceb9be60c02519852763ce55940f
View Raw JSON Data
{
  "trx_id": "0fcf2f7dc5e4ceb9be60c02519852763ce55940f",
  "block": 36679853,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-23T18:20:21",
  "op": [
    "comment",
    {
      "parent_author": "totalrehash",
      "parent_permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "author": "steemcleaners",
      "permlink": "re-totalrehash-thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp-20190923t182020804z",
      "title": "",
      "body": "[Source](https://www.theburningplatform.com/2019/09/18/the-bolsheviks-even-want-to-tax-your-toaster-oven/)\n[Plagiarism](http://www.plagiarism.org/plagiarism-101/what-is-plagiarism/) is the copying & pasting of others work without giving credit to the original author or artist. Plagiarized posts are considered spam. \r\n\r\nSpam is discouraged by the community, and may result in action from the [cheetah bot](https://steemit.com/faq.html#What_is__cheetah).\r\n\r\n[More information and tips on sharing content.](https://steemcleaners.org/copy-paste-plagiarism/)\r\n\r\nIf you believe this comment is in error, please contact us in [#disputes on Discord](https://discord.gg/YR2Wy5A)",
      "json_metadata": "{\"app\":\"steemcleaners/0.3\",\"format\":\"markdown+html\",\"community\":\"steemcleaners\"}"
    }
  ]
}
2019/09/22 19:35:03
votertotalrehash
authortotalrehash
permlinkvideosecretsofhowbitcoinblockchaincametobe-ja8dj6b9ka
weight10000 (100.00%)
Transaction InfoBlock #36652604/Trx 37a642e62dcdf0f5d8cc1f251d012f160ef3360e
View Raw JSON Data
{
  "trx_id": "37a642e62dcdf0f5d8cc1f251d012f160ef3360e",
  "block": 36652604,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-22T19:35:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videosecretsofhowbitcoinblockchaincametobe-ja8dj6b9ka",
      "weight": 10000
    }
  ]
}
2019/09/22 19:29:36
authortotalrehash
permlinkvideosecretsofhowbitcoinblockchaincametobe-ja8dj6b9ka
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36652495/Trx 405acd44e729420ab14b9757ac2032379dbe1b84
View Raw JSON Data
{
  "trx_id": "405acd44e729420ab14b9757ac2032379dbe1b84",
  "block": 36652495,
  "trx_in_block": 39,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-22T19:29:36",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videosecretsofhowbitcoinblockchaincametobe-ja8dj6b9ka",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/22 19:29:36
parent author
parent permlinksteempress
authortotalrehash
permlinkvideosecretsofhowbitcoinblockchaincametobe-ja8dj6b9ka
titleVideo: Secrets of How Bitcoin Blockchain Came To Be
body<p><a href="http://totalrehash.com/wp-content/uploads/2019/09/unnamed.jpg"><img class="aligncenter size-full wp-image-23351" src="http://totalrehash.com/wp-content/uploads/2019/09/unnamed.jpg" alt="" width="821" height="454" /></a>Paul Rosenberg is a true OG from the early days of the internet, one of those rare <em>‘been there done that’</em> types who actually walks the talk.</p> <p>A lifestyle capitalist with a broad range of interests from philosophy, theology, and history to psychology and physics, he’s been involved with cryptography since the 1990s.</p> <p>Paul is a co-founder of the <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187705" target="_blank" rel="noreferrer noopener">Cryptohippie</a> privacy service and author of <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187706" target="_blank" rel="noopener noreferrer"><em>Free-Man’s Perspective</em></a>. Prior to this, his construction and engineering career saw him called as an expert witness in numerous legal cases and recruited as a consultant to several organizations.</p> <p>Rosenberg developed and taught 19 continuing education courses for Iowa State University’s College of Engineering. He also co-founded the Fiber Optic Association and wrote the first ever standard for the installation of fiber optic cables in buildings.</p> <p>On top of all this, privately, Paul was a part of the original group of programmers and hackers which served as a catalyst for those who would develop modern <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187708" rel="target=&quot;_blank&quot; noopener noreferrer">blockchain technology</a>. In other words, <strong>what led to Bitcoin.</strong></p> <p>In late 1992, a small group that met monthly in the San Francisco Bay Area, and was humorously termed "cypherpunks" – derived from <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187709" target="_blank" rel="noopener noreferrer">cipher</a> and <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187710" target="_blank" rel="noopener noreferrer">cyberpunk</a>, launched <em>The Cypherpunks</em> mailing list, which by 1994 had 700 subscribers.</p> <p>It was an active forum with technical discussion ranging over mathematics, cryptography and computer science, as well as some political and philosophical discussion, personal arguments and attacks, etc.</p> <p>Fast-forward to 2019, and Rosenberg recently published <em>The Untold Story of the <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187711" target="_blank" rel="noopener noreferrer">Greatest Crypto Project</a> Ever</em>.</p> <p>While what these people did wasn’t entirely hidden, it was only partly public. For reasons that will become clear as you <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187708" target="_blank" rel="noopener noreferrer">hear this story</a>, no one on the inside has wanted to talk about it <strong>until now</strong>.</p> <p>They probably didn’t do much that was technically illegal, but none of them wanted any "special attention" from the powers that <em>shouldn’t</em> be.</p> <p>"Nonetheless, I think it’s time…" says Paul:</p> <p><a href="http://totalrehash.com/wp-content/uploads/2019/09/unnamed2.jpg"><img class="aligncenter size-full wp-image-23352" src="http://totalrehash.com/wp-content/uploads/2019/09/unnamed2.jpg" alt="" width="831" height="1000" /></a>"A new generation of crypto advocates should be able to learn from what came before them."</p> <p>For <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187712" target="_blank" rel="noopener noreferrer">Anarchast</a> episode 464, I had the chance to speak with the man himself about everything from the 1990’s <strong>free nation project</strong>, a whole cryptographic financial system completed by 2002, to <strong>perpetual travelers</strong>, Extropians, <strong>spies</strong>, and the real purpose of <a href="https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187708" target="_blank" rel="noreferrer noopener">Wikileaks</a>.</p> <p>We also discussed the early solution to the double-spend problem, origins of proof-of-work, why PGP and EGold were so important, Satoshi and building a better future.</p> <p><strong>Enjoy the full interview:</strong></p> <p></p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=ZWD4wV0sKjc&amp;feature=youtu.be </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-secrets-of-how-bitcoin-blockchain-came-to-be/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-secrets-of-how-bitcoin-blockchain-came-to-be/"}
Transaction InfoBlock #36652495/Trx 405acd44e729420ab14b9757ac2032379dbe1b84
View Raw JSON Data
{
  "trx_id": "405acd44e729420ab14b9757ac2032379dbe1b84",
  "block": 36652495,
  "trx_in_block": 39,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-22T19:29:36",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videosecretsofhowbitcoinblockchaincametobe-ja8dj6b9ka",
      "title": "Video: Secrets of How Bitcoin Blockchain Came To Be",
      "body": "<p><a href=\"http://totalrehash.com/wp-content/uploads/2019/09/unnamed.jpg\"><img class=\"aligncenter size-full wp-image-23351\" src=\"http://totalrehash.com/wp-content/uploads/2019/09/unnamed.jpg\" alt=\"\" width=\"821\" height=\"454\" /></a>Paul Rosenberg is a true OG from the early days of the internet, one of those rare <em>‘been there done that’</em> types who actually walks the talk.</p>\n<p>A lifestyle capitalist with a broad range of interests from philosophy, theology, and history to psychology and physics, he’s been involved with cryptography since the 1990s.</p>\n<p>Paul is a co-founder of the <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187705\" target=\"_blank\" rel=\"noreferrer noopener\">Cryptohippie</a> privacy service and author of <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187706\" target=\"_blank\" rel=\"noopener noreferrer\"><em>Free-Man’s Perspective</em></a>. Prior to this, his construction and engineering career saw him called as an expert witness in numerous legal cases and recruited as a consultant to several organizations.</p>\n<p>Rosenberg developed and taught 19 continuing education courses for Iowa State University’s College of Engineering. He also co-founded the Fiber Optic Association and wrote the first ever standard for the installation of fiber optic cables in buildings.</p>\n<p>On top of all this, privately, Paul was a part of the original group of programmers and hackers which served as a catalyst for those who would develop modern <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187708\" rel=\"target=&quot;_blank&quot; noopener noreferrer\">blockchain technology</a>. In other words, <strong>what led to Bitcoin.</strong></p>\n<p>In late 1992, a small group that met monthly in the San Francisco Bay Area, and was humorously termed \"cypherpunks\" – derived from <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187709\" target=\"_blank\" rel=\"noopener noreferrer\">cipher</a> and <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187710\" target=\"_blank\" rel=\"noopener noreferrer\">cyberpunk</a>, launched <em>The Cypherpunks</em> mailing list, which by 1994 had 700 subscribers.</p>\n<p>It was an active forum with technical discussion ranging over mathematics, cryptography and computer science, as well as some political and philosophical discussion, personal arguments and attacks, etc.</p>\n<p>Fast-forward to 2019, and Rosenberg recently published <em>The Untold Story of the <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187711\" target=\"_blank\" rel=\"noopener noreferrer\">Greatest Crypto Project</a> Ever</em>.</p>\n<p>While what these people did wasn’t entirely hidden, it was only partly public. For reasons that will become clear as you <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187708\" target=\"_blank\" rel=\"noopener noreferrer\">hear this story</a>, no one on the inside has wanted to talk about it <strong>until now</strong>.</p>\n<p>They probably didn’t do much that was technically illegal, but none of them wanted any \"special attention\" from the powers that <em>shouldn’t</em> be.</p>\n<p>\"Nonetheless, I think it’s time…\" says Paul:</p>\n<p><a href=\"http://totalrehash.com/wp-content/uploads/2019/09/unnamed2.jpg\"><img class=\"aligncenter size-full wp-image-23352\" src=\"http://totalrehash.com/wp-content/uploads/2019/09/unnamed2.jpg\" alt=\"\" width=\"831\" height=\"1000\" /></a>\"A new generation of crypto advocates should be able to learn from what came before them.\"</p>\n<p>For <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187712\" target=\"_blank\" rel=\"noopener noreferrer\">Anarchast</a> episode 464, I had the chance to speak with the man himself about everything from the 1990’s <strong>free nation project</strong>, a whole cryptographic financial system completed by 2002, to <strong>perpetual travelers</strong>, Extropians, <strong>spies</strong>, and the real purpose of <a href=\"https://dollarvigilante.acemlnb.com/lt.php?s=d20bfedc1cef8609a75be1d3e8c7902e&amp;i=1036A1063A7A187708\" target=\"_blank\" rel=\"noreferrer noopener\">Wikileaks</a>.</p>\n<p>We also discussed the early solution to the double-spend problem, origins of proof-of-work, why PGP and EGold were so important, Satoshi and building a better future.</p>\n<p><strong>Enjoy the full interview:</strong></p>\n<p></p>\n\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=ZWD4wV0sKjc&amp;feature=youtu.be\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-secrets-of-how-bitcoin-blockchain-came-to-be/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-secrets-of-how-bitcoin-blockchain-came-to-be/\"}"
    }
  ]
}
dtubesent 0.001 STEEM to @totalrehash- "DTube Coin Round #1 is live! Visit https://token.d.tube for more information"
2019/09/20 21:42:48
fromdtube
tototalrehash
amount0.001 STEEM
memoDTube Coin Round #1 is live! Visit https://token.d.tube for more information
Transaction InfoBlock #36597672/Trx 6d710c9ab291874704370332144edbdd552d6e58
View Raw JSON Data
{
  "trx_id": "6d710c9ab291874704370332144edbdd552d6e58",
  "block": 36597672,
  "trx_in_block": 22,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T21:42:48",
  "op": [
    "transfer",
    {
      "from": "dtube",
      "to": "totalrehash",
      "amount": "0.001 STEEM",
      "memo": "DTube Coin Round #1 is live! Visit https://token.d.tube for more information"
    }
  ]
}
2019/09/20 21:13:06
parent author
parent permlinksteempress
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
titleThe Bolsheviks even want to tax your toaster oven…
body<a href="http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks.jpg"><img class="alignnone size-medium wp-image-23275" src="http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks-300x131.jpg" alt="" width="300" height="131"/><br/></a> In a concept paper called “Treat Wealth Like Wages”, the ranking member of the US Senate Finance Committee laid out a plan late last week to radically overhaul the tax code in a way never before seen.Just as you’d expect from the title. His central idea is to tax wealth; if you own just about anything, this Senator wants you to start paying an annual tithe to the federal government.It’s sort of like how property tax works: you don’t actually -own- your own property. You’re just renting it from the government.They charge you a tax each year-- some percentage of the property’s value-- to use the land. And if you don’t pay your property taxes, they’ll come and take it from you. Nowthey want to create a similar federal tax that applies to almost every major asset you own.This includes CASH in your bank account. Financial assets like stocks and bonds. Private business and partnership interests. Your entire real estate portfolio. Collectible assets like art and fine wine.Never mind that you’ve bought these assets with money that’s already been taxed. Now they want to tax it again, every year. And when you die they want to tax it again.They even included Individual Retirement Accounts.Hell, for that matter they even proposed taxing “household goods” beyond a certain threshold. So you could even pay tax on your toaster oven.What I found really interesting about this proposal, though, is that the guy who authored it is NOT one of the 10,000 people running for President right now.In fact, this US Senator (Ron Wyden from Oregon) isn’t even up for re-election until 2022, at which point he’ll likely retire. We’d expect to hear about wealth taxes from all the Bolshevik presidential candidates who are seeking attention and headlines. Or from some firebrand Twitter Queen who hates rich people.But Ron Wyden is neither of those. He’s a seasoned, 70-year old US Senator who created a detailed 33-page plan on why AND how to implement a wealth tax.This shows that the idea is really catching fire.The wealth tax, of course, joins a slew of other taxes and hikes that have been proposed by the motley gang of Bolsheviks. Several candidates plan to drastically raise the Death Tax while slashing exemptions. Others want to raise the top income tax rate to 70%. Another wants to tax UNREALIZED (i.e. paper) gains on investments.They always say, of course, that they only want to tax the wealthy. They might even mean it.But take a look at the income tax itself as a great historical example. Whenthe income tax was first implemented in 1913, it was intended to affect only the wealthiest households in America. Plus, the base rate was just 1%, and the top rate was 7%.It was only a few years later that the middle class got ensnared into paying taxes. And by 1922, there were FIFTY SIX different tax brackets, all the way up to 73%, with nearly everyone in America owing a ‘fair share’. Point is, whatever they create to tax the rich almost always ends up affecting the middle class.And this latest proposal shows that the idea of a wealth tax has a LOT of momentum.It’s no longer some lofty sound byte. There are detailed plans and real support behind it… which means you might want to strongly consider your own options for a Plan B.For some people, that might even mean picking up and moving. It’s not such a radical concept… people do it all the time, especially state-to-state. Justa few days ago, Billionaire Carl Icahn announced he was moving to Florida to save on New-York’s ever-increasing taxes.He also said that his whole office is moving with him… and that anyone who doesn’t move won’t have a job anymore.And a long list of billionaires have already moved to Florida to take advantage of this including Paul Tudor Jones, David Tepper, Eddie Lampert, etc.But for those who are willing to leave the mainland, there are even better places.Sir John Templeton, one of the first-ever billionaire investors, moved to the Bahamas late in his career. And from his tax savings alone, he was able to increase his charitable donations by an ADDITIONAL $100 million per year.Puerto Rico is one place that offers exceptional tax advantages; investment income and capital gains are taxed at 0%... and corporate tax is just 4%… all in a tropical paradise that’s a 2 hour flight from the US mainland.US citizens don’t even need a passport to move here. Because Puerto Rico is a US territory, moving to PR is no different than moving from New York to Florida.I’ve said it over and over again, but it’s worth repeating-- these incentives won’t last forever.That’s why I insist the time to start strongly considering them and taking action is NOW.If you’re interested in learning more, <a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432" target="_blank" rel="noreferrer noopener">you can read our in-depth report on Puerto Rico’s tax incentives.</a> <a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432" target="_blank" rel="noreferrer noopener">Simon Black, Founder,&nbsp;</a><a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/4573605601476608/5825820132114432" target="_blank" rel="noreferrer noopener">SovereignMan.com</a> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/"}
Transaction InfoBlock #36597079/Trx 2e195a4215a9fe11f7c70e632cb915283d287a86
View Raw JSON Data
{
  "trx_id": "2e195a4215a9fe11f7c70e632cb915283d287a86",
  "block": 36597079,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T21:13:06",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "title": "The Bolsheviks even want to tax your toaster oven…",
      "body": "<a href=\"http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks.jpg\"><img class=\"alignnone size-medium wp-image-23275\" src=\"http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks-300x131.jpg\" alt=\"\" width=\"300\" height=\"131\"/><br/></a>\n\nIn a concept paper called “Treat Wealth Like Wages”, the ranking member of the US Senate Finance Committee laid out a plan late last week to radically overhaul the tax code in a way never before seen.Just as you’d expect from the title.\n\nHis central idea is to tax wealth; if you own just about anything, this Senator wants you to start paying an annual tithe to the federal government.It’s sort of like how property tax works: you don’t actually -own- your own property. You’re just renting it from the government.They charge you a tax each year-- some percentage of the property’s value-- to use the land. And if you don’t pay your property taxes, they’ll come and take it from you.\n\nNowthey want to create a similar federal tax that applies to almost every major asset you own.This includes CASH in your bank account. Financial assets like stocks and bonds. Private business and partnership interests. Your entire real estate portfolio. Collectible assets like art and fine wine.Never mind that you’ve bought these assets with money that’s already been taxed. Now they want to tax it again, every year.\n\nAnd when you die they want to tax it again.They even included Individual Retirement Accounts.Hell, for that matter they even proposed taxing “household goods” beyond a certain threshold. So you could even pay tax on your toaster oven.What I found really interesting about this proposal, though, is that the guy who authored it is NOT one of the 10,000 people running for President right now.In fact, this US Senator (Ron Wyden from Oregon) isn’t even up for re-election until 2022, at which point he’ll likely retire.\n\nWe’d expect to hear about wealth taxes from all the Bolshevik presidential candidates who are seeking attention and headlines. Or from some firebrand Twitter Queen who hates rich people.But Ron Wyden is neither of those. He’s a seasoned, 70-year old US Senator who created a detailed 33-page plan on why AND how to implement a wealth tax.This shows that the idea is really catching fire.The wealth tax, of course, joins a slew of other taxes and hikes that have been proposed by the motley gang of Bolsheviks.\n\nSeveral candidates plan to drastically raise the Death Tax while slashing exemptions. Others want to raise the top income tax rate to 70%. Another wants to tax UNREALIZED (i.e. paper) gains on investments.They always say, of course, that they only want to tax the wealthy. They might even mean it.But take a look at the income tax itself as a great historical example.\n\nWhenthe income tax was first implemented in 1913, it was intended to affect only the wealthiest households in America. Plus, the base rate was just 1%, and the top rate was 7%.It was only a few years later that the middle class got ensnared into paying taxes. And by 1922, there were FIFTY SIX different tax brackets, all the way up to 73%, with nearly everyone in America owing a ‘fair share’.\n\nPoint is, whatever they create to tax the rich almost always ends up affecting the middle class.And this latest proposal shows that the idea of a wealth tax has a LOT of momentum.It’s no longer some lofty sound byte. There are detailed plans and real support behind it… which means you might want to strongly consider your own options for a Plan B.For some people, that might even mean picking up and moving. It’s not such a radical concept… people do it all the time, especially state-to-state.\n\nJusta few days ago, Billionaire Carl Icahn announced he was moving to Florida to save on New-York’s ever-increasing taxes.He also said that his whole office is moving with him… and that anyone who doesn’t move won’t have a job anymore.And a long list of billionaires have already moved to Florida to take advantage of this including Paul Tudor Jones, David Tepper, Eddie Lampert, etc.But for those who are willing to leave the mainland, there are even better places.Sir John Templeton, one of the first-ever billionaire investors, moved to the Bahamas late in his career.\n\nAnd from his tax savings alone, he was able to increase his charitable donations by an ADDITIONAL $100 million per year.Puerto Rico is one place that offers exceptional tax advantages; investment income and capital gains are taxed at 0%... and corporate tax is just 4%… all in a tropical paradise that’s a 2 hour flight from the US mainland.US citizens don’t even need a passport to move here.\n\nBecause Puerto Rico is a US territory, moving to PR is no different than moving from New York to Florida.I’ve said it over and over again, but it’s worth repeating-- these incentives won’t last forever.That’s why I insist the time to start strongly considering them and taking action is NOW.If you’re interested in learning more, <a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">you can read our in-depth report on Puerto Rico’s tax incentives.</a>\n\n<a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">Simon Black,\nFounder,&nbsp;</a><a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/4573605601476608/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">SovereignMan.com</a> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/\"}"
    }
  ]
}
2019/09/20 21:11:57
parent author
parent permlinksteempress
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
titleThe Bolsheviks even want to tax your toaster oven…
body<a href="http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks.jpg"><img class="alignnone size-medium wp-image-23275" src="http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks-300x131.jpg" alt="" width="300" height="131" /><br/></a> In a concept paper called “Treat Wealth Like Wages”, the ranking member of the US Senate Finance Committee laid out a plan late last week to radically overhaul the tax code in a way never before seen.Just as you’d expect from the title. His central idea is to tax wealth; if you own just about anything, this Senator wants you to start paying an annual tithe to the federal government.It’s sort of like how property tax works: you don’t actually -own- your own property. You’re just renting it from the government.They charge you a tax each year-- some percentage of the property’s value-- to use the land. And if you don’t pay your property taxes, they’ll come and take it from you. Nowthey want to create a similar federal tax that applies to almost every major asset you own.This includes CASH in your bank account. Financial assets like stocks and bonds. Private business and partnership interests. Your entire real estate portfolio. Collectible assets like art and fine wine.Never mind that you’ve bought these assets with money that’s already been taxed. Now they want to tax it again, every year. And when you die they want to tax it again.They even included Individual Retirement Accounts.Hell, for that matter they even proposed taxing “household goods” beyond a certain threshold. So you could even pay tax on your toaster oven.What I found really interesting about this proposal, though, is that the guy who authored it is NOT one of the 10,000 people running for President right now.In fact, this US Senator (Ron Wyden from Oregon) isn’t even up for re-election until 2022, at which point he’ll likely retire. We’d expect to hear about wealth taxes from all the Bolshevik presidential candidates who are seeking attention and headlines. Or from some firebrand Twitter Queen who hates rich people.But Ron Wyden is neither of those. He’s a seasoned, 70-year old US Senator who created a detailed 33-page plan on why AND how to implement a wealth tax.This shows that the idea is really catching fire.The wealth tax, of course, joins a slew of other taxes and hikes that have been proposed by the motley gang of Bolsheviks. Several candidates plan to drastically raise the Death Tax while slashing exemptions. Others want to raise the top income tax rate to 70%. Another wants to tax UNREALIZED (i.e. paper) gains on investments.They always say, of course, that they only want to tax the wealthy. They might even mean it.But take a look at the income tax itself as a great historical example. Whenthe income tax was first implemented in 1913, it was intended to affect only the wealthiest households in America. Plus, the base rate was just 1%, and the top rate was 7%.It was only a few years later that the middle class got ensnared into paying taxes. And by 1922, there were FIFTY SIX different tax brackets, all the way up to 73%, with nearly everyone in America owing a ‘fair share’. Point is, whatever they create to tax the rich almost always ends up affecting the middle class.And this latest proposal shows that the idea of a wealth tax has a LOT of momentum.It’s no longer some lofty sound byte. There are detailed plans and real support behind it… which means you might want to strongly consider your own options for a Plan B.For some people, that might even mean picking up and moving. It’s not such a radical concept… people do it all the time, especially state-to-state. Justa few days ago, Billionaire Carl Icahn announced he was moving to Florida to save on New-York’s ever-increasing taxes.He also said that his whole office is moving with him… and that anyone who doesn’t move won’t have a job anymore.And a long list of billionaires have already moved to Florida to take advantage of this including Paul Tudor Jones, David Tepper, Eddie Lampert, etc.But for those who are willing to leave the mainland, there are even better places.Sir John Templeton, one of the first-ever billionaire investors, moved to the Bahamas late in his career. And from his tax savings alone, he was able to increase his charitable donations by an ADDITIONAL $100 million per year.Puerto Rico is one place that offers exceptional tax advantages; investment income and capital gains are taxed at 0%... and corporate tax is just 4%… all in a tropical paradise that’s a 2 hour flight from the US mainland.US citizens don’t even need a passport to move here. Because Puerto Rico is a US territory, moving to PR is no different than moving from New York to Florida.I’ve said it over and over again, but it’s worth repeating-- these incentives won’t last forever.That’s why I insist the time to start strongly considering them and taking action is NOW.If you’re interested in learning more, <a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432" target="_blank" rel="noreferrer noopener">you can read our in-depth report on Puerto Rico’s tax incentives.</a> <a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432" target="_blank" rel="noreferrer noopener">Simon Black, Founder, </a><a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/4573605601476608/5825820132114432" target="_blank" rel="noreferrer noopener">SovereignMan.com</a> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/"}
Transaction InfoBlock #36597056/Trx cdf9128cf6ff5dce6fa571a4fa52db5faea4a1fe
View Raw JSON Data
{
  "trx_id": "cdf9128cf6ff5dce6fa571a4fa52db5faea4a1fe",
  "block": 36597056,
  "trx_in_block": 43,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T21:11:57",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "title": "The Bolsheviks even want to tax your toaster oven…",
      "body": "<a href=\"http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks.jpg\"><img class=\"alignnone size-medium wp-image-23275\" src=\"http://totalrehash.com/wp-content/uploads/2019/09/Bolsheviks-300x131.jpg\" alt=\"\" width=\"300\" height=\"131\" /><br/></a>\n\nIn a concept paper called “Treat Wealth Like Wages”, the ranking member of the US Senate Finance Committee laid out a plan late last week to radically overhaul the tax code in a way never before seen.Just as you’d expect from the title.\n\nHis central idea is to tax wealth; if you own just about anything, this Senator wants you to start paying an annual tithe to the federal government.It’s sort of like how property tax works: you don’t actually -own- your own property. You’re just renting it from the government.They charge you a tax each year-- some percentage of the property’s value-- to use the land. And if you don’t pay your property taxes, they’ll come and take it from you.\n\nNowthey want to create a similar federal tax that applies to almost every major asset you own.This includes CASH in your bank account. Financial assets like stocks and bonds. Private business and partnership interests. Your entire real estate portfolio. Collectible assets like art and fine wine.Never mind that you’ve bought these assets with money that’s already been taxed. Now they want to tax it again, every year.\n\nAnd when you die they want to tax it again.They even included Individual Retirement Accounts.Hell, for that matter they even proposed taxing “household goods” beyond a certain threshold. So you could even pay tax on your toaster oven.What I found really interesting about this proposal, though, is that the guy who authored it is NOT one of the 10,000 people running for President right now.In fact, this US Senator (Ron Wyden from Oregon) isn’t even up for re-election until 2022, at which point he’ll likely retire.\n\nWe’d expect to hear about wealth taxes from all the Bolshevik presidential candidates who are seeking attention and headlines. Or from some firebrand Twitter Queen who hates rich people.But Ron Wyden is neither of those. He’s a seasoned, 70-year old US Senator who created a detailed 33-page plan on why AND how to implement a wealth tax.This shows that the idea is really catching fire.The wealth tax, of course, joins a slew of other taxes and hikes that have been proposed by the motley gang of Bolsheviks.\n\nSeveral candidates plan to drastically raise the Death Tax while slashing exemptions. Others want to raise the top income tax rate to 70%. Another wants to tax UNREALIZED (i.e. paper) gains on investments.They always say, of course, that they only want to tax the wealthy. They might even mean it.But take a look at the income tax itself as a great historical example.\n\nWhenthe income tax was first implemented in 1913, it was intended to affect only the wealthiest households in America. Plus, the base rate was just 1%, and the top rate was 7%.It was only a few years later that the middle class got ensnared into paying taxes. And by 1922, there were FIFTY SIX different tax brackets, all the way up to 73%, with nearly everyone in America owing a ‘fair share’.\n\nPoint is, whatever they create to tax the rich almost always ends up affecting the middle class.And this latest proposal shows that the idea of a wealth tax has a LOT of momentum.It’s no longer some lofty sound byte. There are detailed plans and real support behind it… which means you might want to strongly consider your own options for a Plan B.For some people, that might even mean picking up and moving. It’s not such a radical concept… people do it all the time, especially state-to-state.\n\nJusta few days ago, Billionaire Carl Icahn announced he was moving to Florida to save on New-York’s ever-increasing taxes.He also said that his whole office is moving with him… and that anyone who doesn’t move won’t have a job anymore.And a long list of billionaires have already moved to Florida to take advantage of this including Paul Tudor Jones, David Tepper, Eddie Lampert, etc.But for those who are willing to leave the mainland, there are even better places.Sir John Templeton, one of the first-ever billionaire investors, moved to the Bahamas late in his career.\n\nAnd from his tax savings alone, he was able to increase his charitable donations by an ADDITIONAL $100 million per year.Puerto Rico is one place that offers exceptional tax advantages; investment income and capital gains are taxed at 0%... and corporate tax is just 4%… all in a tropical paradise that’s a 2 hour flight from the US mainland.US citizens don’t even need a passport to move here.\n\nBecause Puerto Rico is a US territory, moving to PR is no different than moving from New York to Florida.I’ve said it over and over again, but it’s worth repeating-- these incentives won’t last forever.That’s why I insist the time to start strongly considering them and taking action is NOW.If you’re interested in learning more, <a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">you can read our in-depth report on Puerto Rico’s tax incentives.</a>\n\n<a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">Simon Black,\nFounder, </a><a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/4573605601476608/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">SovereignMan.com</a> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/\"}"
    }
  ]
}
2019/09/20 20:14:00
votertotalrehash
authortotalrehash
permlinkvideothesuppressedhistoryoftheunitedstatesalluspresidentsrelatedtothisonekingselectedorelected-kl6duwqozv
weight10000 (100.00%)
Transaction InfoBlock #36595899/Trx 0748e5a3da64ab1fef3d64e4e4618c14813bf6a7
View Raw JSON Data
{
  "trx_id": "0748e5a3da64ab1fef3d64e4e4618c14813bf6a7",
  "block": 36595899,
  "trx_in_block": 29,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T20:14:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videothesuppressedhistoryoftheunitedstatesalluspresidentsrelatedtothisonekingselectedorelected-kl6duwqozv",
      "weight": 10000
    }
  ]
}
2019/09/20 20:08:06
authortotalrehash
permlinkvideothesuppressedhistoryoftheunitedstatesalluspresidentsrelatedtothisonekingselectedorelected-kl6duwqozv
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36595782/Trx bea99ade131686eef74843c4acb338fc0d5f78a0
View Raw JSON Data
{
  "trx_id": "bea99ade131686eef74843c4acb338fc0d5f78a0",
  "block": 36595782,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T20:08:06",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videothesuppressedhistoryoftheunitedstatesalluspresidentsrelatedtothisonekingselectedorelected-kl6duwqozv",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/20 20:08:06
parent author
parent permlinksteempress
authortotalrehash
permlinkvideothesuppressedhistoryoftheunitedstatesalluspresidentsrelatedtothisonekingselectedorelected-kl6duwqozv
titleVideo: The #Suppressed History of the United States: All US #Presidents Related to This One #King? #Selected or Elected?
body<img src="https://m.beforeitsnews.com/contributor/upload/106013/images/Screen-Shot-2019-03-12-at-1_30_21-PM.jpg" alt=""/> <p>“Americans MUST watch: the #Suppressed History of the United States” is a collection of videos I’ve uploaded on my channel previously, all of which have stood alone to tell the forgotten and often times hidden history of America, but in this video, I’ve merged them all together to provide a more complete understanding of why the past is so important in analyzing the present.</p> <p>In a post-American revolution society, it would seem like the divine rights of kings would be a distant memory, but is the reality really so? Do certain bloodlines still hold power within our current government system? And if all US presidents are somehow united in blood, does that mean our leaders are really elected by the people? Or does that mean they’re selected by few?</p> <p>About reallygraceful: On this channel, I talk about suppressed history by connecting the past to the present. On the daily, we’re inundated with breaking news headlines propagated on the radio, television, and social media. It’s my goal to provide context so that we can collectively navigate through this information labyrinth.</p> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=5uIN4ZjwBO8 </div> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=ZC4BIkRxoVs </div> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-suppressed-history-of-the-united-states-all-us-presidents-related-to-this-one-king-selected-or-elected/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-the-suppressed-history-of-the-united-states-all-us-presidents-related-to-this-one-king-selected-or-elected/"}
Transaction InfoBlock #36595782/Trx bea99ade131686eef74843c4acb338fc0d5f78a0
View Raw JSON Data
{
  "trx_id": "bea99ade131686eef74843c4acb338fc0d5f78a0",
  "block": 36595782,
  "trx_in_block": 6,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T20:08:06",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videothesuppressedhistoryoftheunitedstatesalluspresidentsrelatedtothisonekingselectedorelected-kl6duwqozv",
      "title": "Video: The #Suppressed History of the United States: All US #Presidents Related to This One #King? #Selected or Elected?",
      "body": "<img src=\"https://m.beforeitsnews.com/contributor/upload/106013/images/Screen-Shot-2019-03-12-at-1_30_21-PM.jpg\" alt=\"\"/>\n<p>“Americans MUST watch: the #Suppressed History of the United States”  is a collection of videos I’ve uploaded on my channel previously, all of  which have stood alone to tell the forgotten and often times hidden  history of America, but in this video, I’ve merged them all together to  provide a more complete understanding of why the past is so important in  analyzing the present.</p>\n<p>In a post-American revolution society, it would seem like the divine \nrights of kings would be a distant memory, but is the reality really so?\n Do certain bloodlines still hold power within our current government \nsystem? And if all US presidents are somehow united in blood, does that \nmean our leaders are really elected by the people? Or does that mean \nthey’re selected by few?</p>\n<p>About reallygraceful: On this channel, I talk about suppressed  history by connecting the past to the present. On the daily, we’re  inundated with breaking news headlines propagated on the radio,  television, and social media. It’s my goal to provide context so that we  can collectively navigate through this information labyrinth.</p>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=5uIN4ZjwBO8\n</div>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=ZC4BIkRxoVs\n</div>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-suppressed-history-of-the-united-states-all-us-presidents-related-to-this-one-king-selected-or-elected/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-the-suppressed-history-of-the-united-states-all-us-presidents-related-to-this-one-king-selected-or-elected/\"}"
    }
  ]
}
2019/09/20 01:23:15
parent authortotalrehash
parent permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
authorsteemitboard
permlinksteemitboard-notify-totalrehash-20190920t012314000z
title
bodyCongratulations @totalrehash! You have completed the following achievement on the Steem blockchain and have been rewarded with new badge(s) : <table><tr><td><img src="https://steemitimages.com/60x70/http://steemitboard.com/@totalrehash/posts.png?201909200040"></td><td>You published more than 70 posts. Your next target is to reach 80 posts.</td></tr> </table> <sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@totalrehash) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=totalrehash)_</sub> <sub>_If you no longer want to receive notifications, reply to this comment with the word_ `STOP`</sub> ###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #36573330/Trx e95ba3ec7a15338b1b4481e1ee6ae6522ba381ec
View Raw JSON Data
{
  "trx_id": "e95ba3ec7a15338b1b4481e1ee6ae6522ba381ec",
  "block": 36573330,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T01:23:15",
  "op": [
    "comment",
    {
      "parent_author": "totalrehash",
      "parent_permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-totalrehash-20190920t012314000z",
      "title": "",
      "body": "Congratulations @totalrehash! You have completed the following achievement on the Steem blockchain and have been rewarded with new badge(s) :\n\n<table><tr><td><img src=\"https://steemitimages.com/60x70/http://steemitboard.com/@totalrehash/posts.png?201909200040\"></td><td>You published more than 70 posts. Your next target is to reach 80 posts.</td></tr>\n</table>\n\n<sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@totalrehash) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=totalrehash)_</sub>\n<sub>_If you no longer want to receive notifications, reply to this comment with the word_ `STOP`</sub>\n\n\n\n###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2019/09/20 00:03:00
votertotalrehash
authortotalrehash
permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
weight10000 (100.00%)
Transaction InfoBlock #36571728/Trx 5b523a593fc06981de6675916e64b928e7a55f59
View Raw JSON Data
{
  "trx_id": "5b523a593fc06981de6675916e64b928e7a55f59",
  "block": 36571728,
  "trx_in_block": 24,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-20T00:03:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "weight": 10000
    }
  ]
}
2019/09/19 23:58:21
voteranomaly
authortotalrehash
permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
weight100 (1.00%)
Transaction InfoBlock #36571635/Trx e9a6e2131e34f6a13ed0548c75871f4191da2a12
View Raw JSON Data
{
  "trx_id": "e9a6e2131e34f6a13ed0548c75871f4191da2a12",
  "block": 36571635,
  "trx_in_block": 12,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:58:21",
  "op": [
    "vote",
    {
      "voter": "anomaly",
      "author": "totalrehash",
      "permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "weight": 100
    }
  ]
}
2019/09/19 23:57:39
parent authortotalrehash
parent permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
authorcheetah
permlinkcheetah-re-totalrehashvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
title
bodyHi! I am a robot. I just upvoted you! I found similar content that readers might be interested in: http://www.project.nsearch.com/xn/detail/4878805:BlogPost:881379
json metadata
Transaction InfoBlock #36571621/Trx e4d6ed38cf56d1e8bae446f224773a07954aee93
View Raw JSON Data
{
  "trx_id": "e4d6ed38cf56d1e8bae446f224773a07954aee93",
  "block": 36571621,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:57:39",
  "op": [
    "comment",
    {
      "parent_author": "totalrehash",
      "parent_permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "author": "cheetah",
      "permlink": "cheetah-re-totalrehashvideothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "title": "",
      "body": "Hi! I am a robot. I just upvoted you! I found similar content that readers might be interested in:\nhttp://www.project.nsearch.com/xn/detail/4878805:BlogPost:881379",
      "json_metadata": ""
    }
  ]
}
2019/09/19 23:57:36
votercheetah
authortotalrehash
permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
weight8 (0.08%)
Transaction InfoBlock #36571620/Trx c4c953b6747ed32fc8a02442b333cbcbf58c7c4e
View Raw JSON Data
{
  "trx_id": "c4c953b6747ed32fc8a02442b333cbcbf58c7c4e",
  "block": 36571620,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:57:36",
  "op": [
    "vote",
    {
      "voter": "cheetah",
      "author": "totalrehash",
      "permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "weight": 8
    }
  ]
}
2019/09/19 23:57:21
authortotalrehash
permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36571615/Trx 71ed2627491ccf62135afa9558014307521abe96
View Raw JSON Data
{
  "trx_id": "71ed2627491ccf62135afa9558014307521abe96",
  "block": 36571615,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:57:21",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/19 23:57:21
parent author
parent permlinksteempress
authortotalrehash
permlinkvideothemassesarecluelessabout5gmaxigan-krubd4wyn7
titleVideo: The Masses Are #Clueless about 5G! Max Igan
body<p>great #information on #5G This is the information not found on Fox News and the rest of the Fake News on our Tel-Lie-Visions! Have you joined the worldwide boycott of all fake news yet? Stop watching all of it and see how much better you feel! Tweet Trump @potus and @realdonaldtrump and tell him he will be responsible for all the death and the cancers if HE doesn’t demand testing on rats and other animals before 5G is aimed at us! We hold him and all others responsible for the deaths and cancers that follow. </p> <p>This is not just more speed! This is a pencil sized beam of radiation shooting directly at your body or into your head! It can be aimed at you while you sleep even if the phone is off! This entire 5G stuff is nothing but a scam to depopulate and control the planet. </p> <p>Send this article and video far and wide. Tell people they must wake up. Remember Eric Schmidt’s girlfriend said the Chinese planned to sterilize the entire US population with 5G and then disarm us with their Atlas robots! The information on how the Chinese plan to sterilize you and your children with 5G before you know it is located in this article!</p> <p> Get it everywhere because Sean Hannity sure won’t!</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=H_BnnvuENbI </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-masses-are-clueless-about-5g-max-igan/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-the-masses-are-clueless-about-5g-max-igan/"}
Transaction InfoBlock #36571615/Trx 71ed2627491ccf62135afa9558014307521abe96
View Raw JSON Data
{
  "trx_id": "71ed2627491ccf62135afa9558014307521abe96",
  "block": 36571615,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:57:21",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videothemassesarecluelessabout5gmaxigan-krubd4wyn7",
      "title": "Video: The Masses Are #Clueless about 5G! Max Igan",
      "body": "<p>great #information on #5G  This is the information not found on Fox News and the rest of the Fake News on our Tel-Lie-Visions!   Have you joined the worldwide boycott of all fake news yet?   Stop watching all of it and see how much better you feel!    Tweet Trump @potus and @realdonaldtrump and tell him he will be responsible for all the death and the cancers if HE doesn’t demand testing on rats and other animals before 5G is aimed at us!  We hold him and all others responsible for the deaths and cancers that follow.  </p>\n<p>This is not just more speed!  This is a pencil sized beam of radiation shooting directly at your body or into your head!  It can be aimed at you while you sleep even if the phone is off!   This entire 5G stuff is nothing but a scam to depopulate and control the planet.   </p>\n<p>Send this article and video far and wide.  Tell people they must wake up.  Remember Eric Schmidt’s girlfriend said the Chinese planned to sterilize the entire US population with 5G and then disarm us with their Atlas robots!   The information on how the Chinese plan to sterilize you and your children with 5G before you know it is located in this article!</p>\n<p>   Get it everywhere because Sean Hannity sure won’t!</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=H_BnnvuENbI\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-masses-are-clueless-about-5g-max-igan/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-the-masses-are-clueless-about-5g-max-igan/\"}"
    }
  ]
}
2019/09/19 23:50:03
votertotalrehash
authortotalrehash
permlinkvideomarktaylor-armageddonuponthem-dotyo5x408
weight10000 (100.00%)
Transaction InfoBlock #36571471/Trx 6927979f6113d87e5ae7b759528f2ddf6e043367
View Raw JSON Data
{
  "trx_id": "6927979f6113d87e5ae7b759528f2ddf6e043367",
  "block": 36571471,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:50:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videomarktaylor-armageddonuponthem-dotyo5x408",
      "weight": 10000
    }
  ]
}
2019/09/19 23:44:27
parent authortotalrehash
parent permlinkvideomarktaylor-armageddonuponthem-dotyo5x408
authorcheetah
permlinkcheetah-re-totalrehashvideomarktaylor-armageddonuponthem-dotyo5x408
title
bodyHi! I am a robot. I just upvoted you! I found similar content that readers might be interested in: https://www.raptureready.com/2019/08/11/signs-around-us-daymond-duck/
json metadata
Transaction InfoBlock #36571359/Trx 45d5277f41b2d73ffa0e8b1ff84d6d85f508824e
View Raw JSON Data
{
  "trx_id": "45d5277f41b2d73ffa0e8b1ff84d6d85f508824e",
  "block": 36571359,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:44:27",
  "op": [
    "comment",
    {
      "parent_author": "totalrehash",
      "parent_permlink": "videomarktaylor-armageddonuponthem-dotyo5x408",
      "author": "cheetah",
      "permlink": "cheetah-re-totalrehashvideomarktaylor-armageddonuponthem-dotyo5x408",
      "title": "",
      "body": "Hi! I am a robot. I just upvoted you! I found similar content that readers might be interested in:\nhttps://www.raptureready.com/2019/08/11/signs-around-us-daymond-duck/",
      "json_metadata": ""
    }
  ]
}
2019/09/19 23:44:24
votercheetah
authortotalrehash
permlinkvideomarktaylor-armageddonuponthem-dotyo5x408
weight8 (0.08%)
Transaction InfoBlock #36571358/Trx 650a8a0583f387d26412146ccf9e78c0012c2c9d
View Raw JSON Data
{
  "trx_id": "650a8a0583f387d26412146ccf9e78c0012c2c9d",
  "block": 36571358,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:44:24",
  "op": [
    "vote",
    {
      "voter": "cheetah",
      "author": "totalrehash",
      "permlink": "videomarktaylor-armageddonuponthem-dotyo5x408",
      "weight": 8
    }
  ]
}
2019/09/19 23:44:09
authortotalrehash
permlinkvideomarktaylor-armageddonuponthem-dotyo5x408
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36571353/Trx a3f2e8f178ac71885d811be23bb5fb40dca87aee
View Raw JSON Data
{
  "trx_id": "a3f2e8f178ac71885d811be23bb5fb40dca87aee",
  "block": 36571353,
  "trx_in_block": 11,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:44:09",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videomarktaylor-armageddonuponthem-dotyo5x408",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/19 23:44:09
parent author
parent permlinksteempress
authortotalrehash
permlinkvideomarktaylor-armageddonuponthem-dotyo5x408
titleVideo: Mark Taylor - Armageddon Upon Them
body<p>Those of us that are watching for the #return of #Jesus can easily see signs of His return all around us.</p> <p>First, in late July 2019, a Facebook executive told Congress the “Libra” (Facebook’s desired global currency) could be a valuable tool for law enforcement partly because of the vast amounts of information that will be generated about those that use the currency.</p> <p>He said there will be a transaction record (what you bought or sold, when and where you bought it, what you paid or received for it, etc.) plus a record of who made the transaction.</p> <p>He said law enforcement officials could have access to that information when needed.</p> <p>It is easy for students of Bible prophecy to see that this is a major step toward the Mark of the Beast.</p> <p>Second, on the Aug. 2, 2019, “The Common Sense Show” Dave Hodges reported that Facebook is supporting a global ID system.</p> <p>A global ID is needed for law enforcement to connect the information that is generated when someone buys or sells something to the people that did the buying and selling.</p> <p>Third, an app called FaceApp has gone viral that allows a person to see what they will look like as they age.</p> <p>People that download the app still own their picture, but FaceApp owns an irreversible, royalty-free right to use their picture anyway they want.</p> <p>By downloading the app, people are signing away control over their picture.</p> <p>Fourth, Washington may soon become the 17<sup>th</sup> state in the U.S. to allow three gender options on drivers’ licenses: male, female and X.</p> <p>According to the Bible, God created two genders: male and female.</p> <p>Anything else is ignorance or a rejection of the Word of God.</p> <p>Fifth, in Africa, Christians are being killed and church buildings are being destroyed on a daily basis.</p> <p>In China, school children are being taught to report Christians in their family, church buildings are being destroyed, crosses are being removed, Muslim signs and symbols are being removed, hundreds of thousands of Muslims have been sent to re-education centers, etc.</p> <p>The reports are no longer about a few religions in a few nations.</p> <p>A July 2019 Pew Research report noted significant increases in persecution of all religions on a global scale.</p> <p>Jesus said persecution would increase when His return is getting close, and it is happening.</p> <p>Sixth, in the wake of four tragedies over a five-day period (<strong>One</strong>, Gilroy Garlic Festival, 3 killed, 12 injured;&nbsp;<strong>Two</strong>, El Paso Wal Mart, 22 killed, 24 injured;&nbsp;<strong>Three</strong>, Dayton shooting, 10 killed, 27 injured; and<strong>&nbsp;Four</strong>, Chicago, 40 people shot, 3 killed, 37 injured; July 29-Aug. 3), it seems that at least three signs of the end-of-the age are in play:</p> <p>1) There is a decline of true spirituality in the Church (a&nbsp;<em>form</em>&nbsp;of godliness, a lukewarm attitude; II Thess. 2:3, 5; Rev. 3:16).</p> <p>2) Society is reverting to the way it was in the Days of Noah (great wickedness, evil thoughts; Matt. 24:37; Gen. 6:5).</p> <p>3) Some people are incontinent (lacking self-control), and fierce (II Tim. 3:3).</p> <p>The decline of the Church (declining restraint) in the U.S. is being accompanied by increasing wickedness and a lack of self-control.</p> <p>According to the signs all around us, without repentance in the Church, society will reap a whirlwind.</p> <p>Prophecy Plus Ministries, Inc.<br /> Daymond &amp; Rachel Duck</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=bb8aOa4lcJQ </div></figure> <p><br /><a href="mailto:[email protected]">[email protected]</a></p> <figure class="wp-block-embed-wordpress wp-block-embed is-type-wp-embed is-provider-rapture-ready"><div class="wp-block-embed__wrapper"> https://www.raptureready.com/2019/08/11/signs-around-us-daymond-duck/ </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-mark-taylor-armageddon-upon-them/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-mark-taylor-armageddon-upon-them/"}
Transaction InfoBlock #36571353/Trx a3f2e8f178ac71885d811be23bb5fb40dca87aee
View Raw JSON Data
{
  "trx_id": "a3f2e8f178ac71885d811be23bb5fb40dca87aee",
  "block": 36571353,
  "trx_in_block": 11,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:44:09",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videomarktaylor-armageddonuponthem-dotyo5x408",
      "title": "Video: Mark Taylor - Armageddon Upon Them",
      "body": "<p>Those of us that are watching for the #return of #Jesus can easily see signs of His return all around us.</p>\n<p>First, in late July 2019, a Facebook executive told Congress the \n“Libra” (Facebook’s desired global currency) could be a valuable tool \nfor law enforcement partly because of the vast amounts of information \nthat will be generated about those that use the currency.</p>\n<p>He said there will be a transaction record (what you bought or sold, \nwhen and where you bought it, what you paid or received for it, etc.) \nplus a record of who made the transaction.</p>\n<p>He said law enforcement officials could have access to that information when needed.</p>\n<p>It is easy for students of Bible prophecy to see that this is a major step toward the Mark of the Beast.</p>\n<p>Second, on the Aug. 2, 2019, “The Common Sense Show” Dave Hodges reported that Facebook is supporting a global ID system.</p>\n<p>A global ID is needed for law enforcement to connect the information \nthat is generated when someone buys or sells something to the people \nthat did the buying and selling.</p>\n<p>Third, an app called FaceApp has gone viral that allows a person to see what they will look like as they age.</p>\n<p>People that download the app still own their picture, but FaceApp \nowns an irreversible, royalty-free right to use their picture anyway \nthey want.</p>\n<p>By downloading the app, people are signing away control over their picture.</p>\n<p>Fourth, Washington may soon become the 17<sup>th</sup> state in the U.S. to allow three gender options on drivers’ licenses: male, female and X.</p>\n<p>According to the Bible, God created two genders: male and female.</p>\n<p>Anything else is ignorance or a rejection of the Word of God.</p>\n<p>Fifth, in Africa, Christians are being killed and church buildings are being destroyed on a daily basis.</p>\n<p>In China, school children are being taught to report Christians in \ntheir family, church buildings are being destroyed, crosses are being \nremoved, Muslim signs and symbols are being removed, hundreds of \nthousands of Muslims have been sent to re-education centers, etc.</p>\n<p>The reports are no longer about a few religions in a few nations.</p>\n<p>A July 2019 Pew Research report noted significant increases in persecution of all religions on a global scale.</p>\n<p>Jesus said persecution would increase when His return is getting close, and it is happening.</p>\n<p>Sixth, in the wake of four tragedies over a five-day period (<strong>One</strong>, Gilroy Garlic Festival, 3 killed, 12 injured;&nbsp;<strong>Two</strong>, El Paso Wal Mart, 22 killed, 24 injured;&nbsp;<strong>Three</strong>, Dayton shooting, 10 killed, 27 injured; and<strong>&nbsp;Four</strong>,\n Chicago, 40 people shot, 3 killed, 37 injured; July 29-Aug. 3), it \nseems that at least three signs of the end-of-the age are in play:</p>\n<p>1) There is a decline of true spirituality in the Church (a&nbsp;<em>form</em>&nbsp;of godliness, a lukewarm attitude; II Thess. 2:3, 5; Rev. 3:16).</p>\n<p>2) Society is reverting to the way it was in the Days of Noah (great wickedness, evil thoughts; Matt. 24:37; Gen. 6:5).</p>\n<p>3) Some people are incontinent (lacking self-control), and fierce (II Tim. 3:3).</p>\n<p>The decline of the Church (declining restraint) in the U.S. is being \naccompanied by increasing wickedness and a lack of self-control.</p>\n<p>According to the signs all around us, without repentance in the Church, society will reap a whirlwind.</p>\n<p>Prophecy Plus Ministries, Inc.<br /> Daymond &amp; Rachel Duck</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=bb8aOa4lcJQ\n</div></figure>\n<p><br /><a href=\"mailto:[email protected]\">[email protected]</a></p>\n<figure class=\"wp-block-embed-wordpress wp-block-embed is-type-wp-embed is-provider-rapture-ready\"><div class=\"wp-block-embed__wrapper\">\nhttps://www.raptureready.com/2019/08/11/signs-around-us-daymond-duck/\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-mark-taylor-armageddon-upon-them/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-mark-taylor-armageddon-upon-them/\"}"
    }
  ]
}
2019/09/19 23:39:00
votertotalrehash
authortotalrehash
permlinkvideomarktaylorthetipoftheiceberg-6t8alre6j6
weight10000 (100.00%)
Transaction InfoBlock #36571250/Trx f68b6bea02103476b8d5997877b63f9a0ec6c812
View Raw JSON Data
{
  "trx_id": "f68b6bea02103476b8d5997877b63f9a0ec6c812",
  "block": 36571250,
  "trx_in_block": 15,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:39:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videomarktaylorthetipoftheiceberg-6t8alre6j6",
      "weight": 10000
    }
  ]
}
2019/09/19 23:33:51
authortotalrehash
permlinkvideomarktaylorthetipoftheiceberg-6t8alre6j6
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36571147/Trx dbf73c93f11c0c3ebe061133bfd45c60694c5b4d
View Raw JSON Data
{
  "trx_id": "dbf73c93f11c0c3ebe061133bfd45c60694c5b4d",
  "block": 36571147,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:33:51",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videomarktaylorthetipoftheiceberg-6t8alre6j6",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/19 23:33:51
parent author
parent permlinksteempress
authortotalrehash
permlinkvideomarktaylorthetipoftheiceberg-6t8alre6j6
titleVideo: Mark Taylor: The Tip of the Iceberg
body<h2>#<strong>Democrats Officially Become Party of the #Godless</strong></h2> <p>The Democratic National Committee (DNC) passed a resolution adopting the “religiously unaffiliated” as the largest religious group within the Democratic Party. In a pointed underscore of the dying Church in America, the DNC resolution opened with the following statement:</p> <p>“WHEREAS, the religiously unaffiliated demographic has tripled in the last two decades, now representing 25% of the overall American population and 35% of those under the age of 30; WHEREAS, religiously unaffiliated Americans overwhelmingly share the Democratic Party’s values, with 70% voting for Democrats in 2018, 80% supporting same-sex marriage, and 61% saying immigrants make American society stronger; and…</p> <p>“WHEREAS, the religiously unaffiliated demographic represents the largest religious group within the Democratic Party, growing from 19% in 2007 to one in three today; and WHEREAS, the nonreligious have often been subjected to unfair bias and exclusion in American society, particularly in the areas of politics and policymaking where assumptions of religiosity have long predominated; and…</p> <p>“WHEREAS, those most loudly claiming that morals, values, and patriotism must be defined by their particular religious views have used those religious views, with misplaced claims of “religious liberty,” to justify public policy that has threatened the civil rights and liberties of many Americans, including but not limited to the LGBT community, women, and ethnic and religious/nonreligious minorities; and…</p> <p>“WHEREAS, the Democratic Party is an inclusive organization that recognizes that morals, values, and patriotism are not unique to any particular religion, and are not necessarily reliant on having a religious worldview at all; and WHEREAS, nonreligious Americans made up 17% of the electorate in 2018 and have the potential to deliver millions more votes for Democrats in 2020 with targeted outreach to further increase turnout of nonreligious voters; and…</p> <p>“WHEREAS, a record number of openly nonreligious candidates are running for public office; NOW, THEREFORE, BE IT RESOLVED, that the DEMOCRATIC NATIONAL COMMITTEE recognizes:</p> <p>“1. The value, ethical soundness, and importance of the religiously unaffiliated demographic, a group of Americans who contribute in innumerable ways to the arts, sciences, medicine, business, law, the military, their communities, the success of the Party and prosperity of the Nation; and 2. That religiously unaffiliated Americans are a group that, as much as any other, advocates for rational public policy based on sound science and universal humanistic values and should be represented, included, and heard by the Party.”</p> <p>There is so much wrong with this Resolution. Where do morals come from, certainly not the immoral? The resolution condemns the religiously affiliated for trampling the rights of almost everyone. In other words, if you are religiously affiliated, you are likely a bigot, a misogynist, a homophobe, a racist or worse. See where this is headed?</p> <p>For the Democratic Party and for America, this is historic. Democratic leadership has chosen to embrace those who are “not reliant on a religious worldview at all” at the expense of those whose religious beliefs define their “morals, values and patriotism.” The DNC states that those who are nonreligious “overwhelmingly share the Democratic Party’s values.” While not denying God, the party is embracing the godless as more moral and sound than believers. The DNC is admitting that godless values are Democrat’s values.</p> <p><strong>Christians who would vote for Democrats, be forewarned: “Be not deceived; God is not mocked: for whatsoever a man sows, that shall he also reap” (Galatians 6:7).</strong></p> <p>More analysis in upcoming Daily Jots.</p> <p>Have a blessed and powerful day,</p> <p>The Daily Jot Staff</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=d43YjiYc998 </div></figure> <p><a href="https://dailyjot.com">https://dailyjot.com</a></p> <figure class="wp-block-embed-wordpress wp-block-embed is-type-wp-embed is-provider-rapture-ready"><div class="wp-block-embed__wrapper"> https://www.raptureready.com/2019/09/04/democrats-officially-become-party-godless-bill-wilson/ </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-mark-taylor-the-tip-of-the-iceberg/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-mark-taylor-the-tip-of-the-iceberg/"}
Transaction InfoBlock #36571147/Trx dbf73c93f11c0c3ebe061133bfd45c60694c5b4d
View Raw JSON Data
{
  "trx_id": "dbf73c93f11c0c3ebe061133bfd45c60694c5b4d",
  "block": 36571147,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:33:51",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videomarktaylorthetipoftheiceberg-6t8alre6j6",
      "title": "Video: Mark Taylor: The Tip of the Iceberg",
      "body": "<h2>#<strong>Democrats Officially Become Party of the #Godless</strong></h2>\n<p>The Democratic National Committee (DNC) passed a resolution adopting  the “religiously unaffiliated” as the largest religious group within the  Democratic Party. In a pointed underscore of the dying Church in  America, the DNC resolution opened with the following statement:</p>\n<p>“WHEREAS, the religiously unaffiliated demographic has tripled in the\n last two decades, now representing 25% of the overall American \npopulation and 35% of those under the age of 30; WHEREAS, religiously \nunaffiliated Americans overwhelmingly share the Democratic Party’s \nvalues, with 70% voting for Democrats in 2018, 80% supporting same-sex \nmarriage, and 61% saying immigrants make American society stronger; and…</p>\n<p>“WHEREAS, the religiously unaffiliated demographic represents the \nlargest religious group within the Democratic Party, growing from 19% in\n 2007 to one in three today; and WHEREAS, the nonreligious have often \nbeen subjected to unfair bias and exclusion in American society, \nparticularly in the areas of politics and policymaking where assumptions\n of religiosity have long predominated; and…</p>\n<p>“WHEREAS, those most loudly claiming that morals, values, and \npatriotism must be defined by their particular religious views have used\n those religious views, with misplaced claims of “religious liberty,” to\n justify public policy that has threatened the civil rights and \nliberties of many Americans, including but not limited to the LGBT \ncommunity, women, and ethnic and religious/nonreligious minorities; and…</p>\n<p>“WHEREAS, the Democratic Party is an inclusive organization that \nrecognizes that morals, values, and patriotism are not unique to any \nparticular religion, and are not necessarily reliant on having a \nreligious worldview at all; and WHEREAS, nonreligious Americans made up \n17% of the electorate in 2018 and have the potential to deliver millions\n more votes for Democrats in 2020 with targeted outreach to further \nincrease turnout of nonreligious voters; and…</p>\n<p>“WHEREAS, a record number of openly nonreligious candidates are  running for public office; NOW, THEREFORE, BE IT RESOLVED, that the  DEMOCRATIC NATIONAL COMMITTEE recognizes:</p>\n<p>“1. The value, ethical soundness, and importance of the religiously \nunaffiliated demographic, a group of Americans who contribute in \ninnumerable ways to the arts, sciences, medicine, business, law, the \nmilitary, their communities, the success of the Party and prosperity of \nthe Nation; and 2. That religiously unaffiliated Americans are a group \nthat, as much as any other, advocates for rational public policy based \non sound science and universal humanistic values and should be \nrepresented, included, and heard by the Party.”</p>\n<p>There is so much wrong with this Resolution. Where do morals come \nfrom, certainly not the immoral? The resolution condemns the religiously\n affiliated for trampling the rights of almost everyone. In other words,\n if you are religiously affiliated, you are likely a bigot, a \nmisogynist, a homophobe, a racist or worse. See where this is headed?</p>\n<p>For the Democratic Party and for America, this is historic. \nDemocratic leadership has chosen to embrace those who are “not reliant \non a religious worldview at all” at the expense of those whose religious\n beliefs define their “morals, values and patriotism.” The DNC states \nthat those who are nonreligious “overwhelmingly share the Democratic \nParty’s values.” While not denying God, the party is embracing the \ngodless as more moral and sound than believers. The DNC is admitting \nthat godless values are Democrat’s values.</p>\n<p><strong>Christians who would vote for Democrats, be forewarned: “Be \nnot deceived; God is not mocked: for whatsoever a man sows, that shall \nhe also reap” (Galatians 6:7).</strong></p>\n<p>More analysis in upcoming Daily Jots.</p>\n<p>Have a blessed and powerful day,</p>\n<p>The Daily Jot Staff</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=d43YjiYc998\n</div></figure>\n<p><a href=\"https://dailyjot.com\">https://dailyjot.com</a></p>\n<figure class=\"wp-block-embed-wordpress wp-block-embed is-type-wp-embed is-provider-rapture-ready\"><div class=\"wp-block-embed__wrapper\">\nhttps://www.raptureready.com/2019/09/04/democrats-officially-become-party-godless-bill-wilson/\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-mark-taylor-the-tip-of-the-iceberg/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-mark-taylor-the-tip-of-the-iceberg/\"}"
    }
  ]
}
2019/09/19 23:18:18
votertotalrehash
authortotalrehash
permlinkvideoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i
weight10000 (100.00%)
Transaction InfoBlock #36570836/Trx 842a1211ea4fbefe77914c3c5b15dcdad920ebba
View Raw JSON Data
{
  "trx_id": "842a1211ea4fbefe77914c3c5b15dcdad920ebba",
  "block": 36570836,
  "trx_in_block": 37,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:18:18",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i",
      "weight": 10000
    }
  ]
}
2019/09/19 23:13:21
voteranomaly
authortotalrehash
permlinkvideoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i
weight100 (1.00%)
Transaction InfoBlock #36570737/Trx 8ea79ff4cc7a8a8b5442f20d804ac486fd7fa1d7
View Raw JSON Data
{
  "trx_id": "8ea79ff4cc7a8a8b5442f20d804ac486fd7fa1d7",
  "block": 36570737,
  "trx_in_block": 7,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:13:21",
  "op": [
    "vote",
    {
      "voter": "anomaly",
      "author": "totalrehash",
      "permlink": "videoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i",
      "weight": 100
    }
  ]
}
2019/09/19 23:12:12
authortotalrehash
permlinkvideoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36570714/Trx f86c10294273491f3ec8f7c34c8fa3684812cdf3
View Raw JSON Data
{
  "trx_id": "f86c10294273491f3ec8f7c34c8fa3684812cdf3",
  "block": 36570714,
  "trx_in_block": 38,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:12:12",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/19 23:12:12
parent author
parent permlinksteempress
authortotalrehash
permlinkvideoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i
titleVideo: Impossible Prediction! Most Devastating Disruption of Food Supply in 10,000 Years Is Coming
body<p>It’s coming faster than anyone could have predicted! A prediction that should be all but impossible!&nbsp; The most devastating disruption of food and agriculture in 10,000 years is coming.&nbsp; America’s heartland has been put on notice and if this dire prediction was to come true…it spells the complete and total end of rural America, the end of Farming and the end of Food as we know it.</p> <p>From Lab to plate, be ready for one of the most stomach turning broadcasts I have done to date.  This one impacts ALL OF US, it impacts what we eat and how it’s going to be made.  Breakfast, Lunch and Dinner will never be the same, but what’s worse, it illustrates the devastating impacts of Agenda 2030 beyond what we had ever expected.</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=_mYVFXvzKbM </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-impossible-prediction-most-devastating-disruption-of-food-supply-in-10000-years-is-coming/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-impossible-prediction-most-devastating-disruption-of-food-supply-in-10000-years-is-coming/"}
Transaction InfoBlock #36570714/Trx f86c10294273491f3ec8f7c34c8fa3684812cdf3
View Raw JSON Data
{
  "trx_id": "f86c10294273491f3ec8f7c34c8fa3684812cdf3",
  "block": 36570714,
  "trx_in_block": 38,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:12:12",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videoimpossiblepredictionmostdevastatingdisruptionoffoodsupplyin10000yearsiscoming-rr0i71bh8i",
      "title": "Video: Impossible Prediction! Most Devastating Disruption of Food Supply in 10,000 Years Is Coming",
      "body": "<p>It’s coming faster than anyone could have predicted! A prediction \nthat should be all but impossible!&nbsp; The most devastating disruption of \nfood and agriculture in 10,000 years is coming.&nbsp; America’s heartland has\n been put on notice and if this dire prediction was to come true…it \nspells the complete and total end of rural America, the end of Farming \nand the end of Food as we know it.</p>\n<p>From Lab to plate, be ready for one of the most stomach turning  broadcasts I have done to date.  This one impacts ALL OF US, it impacts  what we eat and how it’s going to be made.  Breakfast, Lunch and Dinner  will never be the same, but what’s worse, it illustrates the devastating  impacts of Agenda 2030 beyond what we had ever expected.</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=_mYVFXvzKbM\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-impossible-prediction-most-devastating-disruption-of-food-supply-in-10000-years-is-coming/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-impossible-prediction-most-devastating-disruption-of-food-supply-in-10000-years-is-coming/\"}"
    }
  ]
}
2019/09/19 23:05:03
votertotalrehash
authortotalrehash
permlinkvideowereabouttopayaseverepricethefullcollapseofdairyandcattleindustryisnowunderway-uvdd8rs5xa
weight10000 (100.00%)
Transaction InfoBlock #36570571/Trx c0ef9a6dd13c2c1ffdf2bd9c662d2e6ce9c9f3b7
View Raw JSON Data
{
  "trx_id": "c0ef9a6dd13c2c1ffdf2bd9c662d2e6ce9c9f3b7",
  "block": 36570571,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T23:05:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videowereabouttopayaseverepricethefullcollapseofdairyandcattleindustryisnowunderway-uvdd8rs5xa",
      "weight": 10000
    }
  ]
}
2019/09/19 22:59:00
authortotalrehash
permlinkvideowereabouttopayaseverepricethefullcollapseofdairyandcattleindustryisnowunderway-uvdd8rs5xa
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36570450/Trx 8e818b14c7fac00bad11b6782ef644d6a2258f6c
View Raw JSON Data
{
  "trx_id": "8e818b14c7fac00bad11b6782ef644d6a2258f6c",
  "block": 36570450,
  "trx_in_block": 36,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T22:59:00",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videowereabouttopayaseverepricethefullcollapseofdairyandcattleindustryisnowunderway-uvdd8rs5xa",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/19 22:59:00
parent author
parent permlinksteempress
authortotalrehash
permlinkvideowereabouttopayaseverepricethefullcollapseofdairyandcattleindustryisnowunderway-uvdd8rs5xa
titleVideo: We’re About to Pay a Severe Price: The Full Collapse of Dairy and Cattle Industry Is Now Underway
body<p>The #food #collapse isn’t coming, it’s already underway. According to a report, “<a rel="noreferrer noopener" target="_blank" href="https://m.beforeitsnews.com/v3/r2/?url=https://cts.businesswire.com/ct/CT?id=smartlink&amp;url=https%3A%2F%2Fwww.rethinkx.com%2Ffood-and-agriculture&amp;esheet=52096215&amp;newsitemid=20190917005441&amp;lan=en-US&amp;anchor=Rethinking+Food+and+Agriculture+2020-2030+--+The+Second+Domestication+of+Plants+and+Animals%2C+the+Disruption+of+the+Cow%2C+and+the+Collapse+of+Industrial+Livestock+Farming&amp;index=1&amp;md5=d00d74f365455dfff6b25ed16d4d2526"><em>Rethinking Food and Agriculture 2020-2030 — The Second Domestication of Plants and Animals, the Disruption of the Cow, and the Collapse of Industrial Livestock Farming</em></a><em>,”</em> released by RethinkX, the fastest, deepest, most consequential disruption of our food and agriculture is now underway. All that and more in the report below…</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=2fvp4Uqu4yY </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-were-about-to-pay-a-severe-price-the-full-collapse-of-dairy-and-cattle-industry-is-now-underway/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-were-about-to-pay-a-severe-price-the-full-collapse-of-dairy-and-cattle-industry-is-now-underway/"}
Transaction InfoBlock #36570450/Trx 8e818b14c7fac00bad11b6782ef644d6a2258f6c
View Raw JSON Data
{
  "trx_id": "8e818b14c7fac00bad11b6782ef644d6a2258f6c",
  "block": 36570450,
  "trx_in_block": 36,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-19T22:59:00",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videowereabouttopayaseverepricethefullcollapseofdairyandcattleindustryisnowunderway-uvdd8rs5xa",
      "title": "Video: We’re About to Pay a Severe Price: The Full Collapse of Dairy and Cattle Industry Is Now Underway",
      "body": "<p>The #food #collapse isn’t coming, it’s already underway. According to a report, “<a rel=\"noreferrer noopener\" target=\"_blank\" href=\"https://m.beforeitsnews.com/v3/r2/?url=https://cts.businesswire.com/ct/CT?id=smartlink&amp;url=https%3A%2F%2Fwww.rethinkx.com%2Ffood-and-agriculture&amp;esheet=52096215&amp;newsitemid=20190917005441&amp;lan=en-US&amp;anchor=Rethinking+Food+and+Agriculture+2020-2030+--+The+Second+Domestication+of+Plants+and+Animals%2C+the+Disruption+of+the+Cow%2C+and+the+Collapse+of+Industrial+Livestock+Farming&amp;index=1&amp;md5=d00d74f365455dfff6b25ed16d4d2526\"><em>Rethinking  Food and Agriculture 2020-2030 — The Second Domestication of Plants and  Animals, the Disruption of the Cow, and the Collapse of Industrial  Livestock Farming</em></a><em>,”</em> released by RethinkX, the  fastest, deepest, most consequential disruption of our food and  agriculture is now underway. All that and more in the report below…</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=2fvp4Uqu4yY\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-were-about-to-pay-a-severe-price-the-full-collapse-of-dairy-and-cattle-industry-is-now-underway/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-were-about-to-pay-a-severe-price-the-full-collapse-of-dairy-and-cattle-industry-is-now-underway/\"}"
    }
  ]
}
2019/09/18 20:20:03
votertotalrehash
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
weight10000 (100.00%)
Transaction InfoBlock #36538537/Trx 22d614f490408964d91d86789ca0b68cf4dd6b76
View Raw JSON Data
{
  "trx_id": "22d614f490408964d91d86789ca0b68cf4dd6b76",
  "block": 36538537,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-18T20:20:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "weight": 10000
    }
  ]
}
2019/09/18 20:15:24
voterburakakdogan
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
weight10000 (100.00%)
Transaction InfoBlock #36538444/Trx f0dde731b6af348a9c7ec4b9b34d36032940860b
View Raw JSON Data
{
  "trx_id": "f0dde731b6af348a9c7ec4b9b34d36032940860b",
  "block": 36538444,
  "trx_in_block": 12,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-18T20:15:24",
  "op": [
    "vote",
    {
      "voter": "burakakdogan",
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "weight": 10000
    }
  ]
}
2019/09/18 20:14:33
parent authortotalrehash
parent permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
authorcheetah
permlinkcheetah-re-totalrehashthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
title
bodyHi! I am a robot. I just upvoted you! I found similar content that readers might be interested in: https://www.theburningplatform.com/2019/09/18/the-bolsheviks-even-want-to-tax-your-toaster-oven/
json metadata
Transaction InfoBlock #36538427/Trx 4bdf9c0a09650935bc249567552bfa601abcc2ea
View Raw JSON Data
{
  "trx_id": "4bdf9c0a09650935bc249567552bfa601abcc2ea",
  "block": 36538427,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-18T20:14:33",
  "op": [
    "comment",
    {
      "parent_author": "totalrehash",
      "parent_permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "author": "cheetah",
      "permlink": "cheetah-re-totalrehashthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "title": "",
      "body": "Hi! I am a robot. I just upvoted you! I found similar content that readers might be interested in:\nhttps://www.theburningplatform.com/2019/09/18/the-bolsheviks-even-want-to-tax-your-toaster-oven/",
      "json_metadata": ""
    }
  ]
}
2019/09/18 20:14:27
votercheetah
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
weight8 (0.08%)
Transaction InfoBlock #36538425/Trx 9565c945ce341db7e94ae9d212607c61333d7a39
View Raw JSON Data
{
  "trx_id": "9565c945ce341db7e94ae9d212607c61333d7a39",
  "block": 36538425,
  "trx_in_block": 21,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-18T20:14:27",
  "op": [
    "vote",
    {
      "voter": "cheetah",
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "weight": 8
    }
  ]
}
2019/09/18 20:14:12
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36538420/Trx da859712d36f4d9fdc6b12c8c71fa18b9bc29418
View Raw JSON Data
{
  "trx_id": "da859712d36f4d9fdc6b12c8c71fa18b9bc29418",
  "block": 36538420,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-18T20:14:12",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/18 20:14:12
parent author
parent permlinksteempress
authortotalrehash
permlinkthebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp
titleThe Bolsheviks even want to tax your toaster oven…
bodyIn a concept paper called “Treat Wealth Like Wages”, the ranking member of the US Senate Finance Committee laid out a plan late last week to radically overhaul the tax code in a way never before seen.Just as you’d expect from the title, his central idea is to tax wealth; if you own just about anything, this Senator wants you to start paying an annual tithe to the federal government.It’s sort of like how property tax works: you don’t actually -own- your own property. You’re just renting it from the government.They charge you a tax each year-- some percentage of the property’s value-- to use the land. And if you don’t pay your property taxes, they’ll come and take it from you.Now they want to create a similar federal tax that applies to almost every major asset you own.This includes CASH in your bank account. Financial assets like stocks and bonds. Private business and partnership interests. Your entire real estate portfolio. Collectible assets like art and fine wine.Never mind that you’ve bought these assets with money that’s already been taxed. Now they want to tax it again, every year. And when you die they want to tax it again.They even included Individual Retirement Accounts.Hell, for that matter they even proposed taxing “household goods” beyond a certain threshold. So you could even pay tax on your toaster oven.What I found really interesting about this proposal, though, is that the guy who authored it is NOT one of the 10,000 people running for President right now.In fact, this US Senator (Ron Wyden from Oregon) isn’t even up for re-election until 2022, at which point he’ll likely retire.We’d expect to hear about wealth taxes from all the Bolshevik presidential candidates who are seeking attention and headlines. Or from some firebrand Twitter Queen who hates rich people.But Ron Wyden is neither of those. He’s a seasoned, 70-year old US Senator who created a detailed 33-page plan on why AND how to implement a wealth tax.This shows that the idea is really catching fire.The wealth tax, of course, joins a slew of other taxes and hikes that have been proposed by the motley gang of Bolsheviks.Several candidates plan to drastically raise the Death Tax while slashing exemptions. Others want to raise the top income tax rate to 70%. Another wants to tax UNREALIZED (i.e. paper) gains on investments.They always say, of course, that they only want to tax the wealthy. They might even mean it.But take a look at the income tax itself as a great historical example.When the income tax was first implemented in 1913, it was intended to affect only the wealthiest households in America. Plus, the base rate was just 1%, and the top rate was 7%.It was only a few years later that the middle class got ensnared into paying taxes. And by 1922, there were FIFTY SIX different tax brackets, all the way up to 73%, with nearly everyone in America owing a ‘fair share’.Point is, whatever they create to tax the rich almost always ends up affecting the middle class.And this latest proposal shows that the idea of a wealth tax has a LOT of momentum.It’s no longer some lofty sound byte. There are detailed plans and real support behind it… which means you might want to strongly consider your own options for a Plan B.For some people, that might even mean picking up and moving. It’s not such a radical concept… people do it all the time, especially state-to-state.Just a few days ago, Billionaire Carl Icahn announced he was moving to Florida to save on New-York’s ever-increasing taxes.He also said that his whole office is moving with him… and that anyone who doesn’t move won’t have a job anymore.And a long list of billionaires have already moved to Florida to take advantage of this including Paul Tudor Jones, David Tepper, Eddie Lampert, etc.But for those who are willing to leave the mainland, there are even better places.Sir John Templeton, one of the first-ever billionaire investors, moved to the Bahamas late in his career. And from his tax savings alone, he was able to increase his charitable donations by an ADDITIONAL $100 million per year.Puerto Rico is one place that offers exceptional tax advantages; investment income and capital gains are taxed at 0%... and corporate tax is just 4%… all in a tropical paradise that’s a 2 hour flight from the US mainland.US citizens don’t even need a passport to move here. Because Puerto Rico is a US territory, moving to PR is no different than moving from New York to Florida.I’ve said it over and over again, but it’s worth repeating-- these incentives won’t last forever.That’s why I insist the time to start strongly considering them and taking action is NOW.If you’re interested in learning more, <a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432" target="_blank" rel="noreferrer noopener">you can read our in-depth report on Puerto Rico’s tax incentives.</a> <a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432" target="_blank" rel="noreferrer noopener">Simon Black, Founder, </a><a href="https://is-tracking-link-api-prod.appspot.com/api/v1/click/4573605601476608/5825820132114432" target="_blank" rel="noreferrer noopener">SovereignMan.com</a> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/"}
Transaction InfoBlock #36538420/Trx da859712d36f4d9fdc6b12c8c71fa18b9bc29418
View Raw JSON Data
{
  "trx_id": "da859712d36f4d9fdc6b12c8c71fa18b9bc29418",
  "block": 36538420,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-18T20:14:12",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "thebolsheviksevenwanttotaxyourtoasteroven-lgutwpn0jp",
      "title": "The Bolsheviks even want to tax your toaster oven…",
      "body": "In a concept paper called “Treat Wealth Like Wages”, the ranking member of the US Senate Finance Committee laid out a plan late last week to radically overhaul the tax code in a way never before seen.Just as you’d expect from the title, his central idea is to tax wealth; if you own just about anything, this Senator wants you to start paying an annual tithe to the federal government.It’s sort of like how property tax works: you don’t actually -own- your own property. You’re just renting it from the government.They charge you a tax each year-- some percentage of the property’s value-- to use the land. And if you don’t pay your property taxes, they’ll come and take it from you.Now they want to create a similar federal tax that applies to almost every major asset you own.This includes CASH in your bank account. Financial assets like stocks and bonds. Private business and partnership interests. Your entire real estate portfolio. Collectible assets like art and fine wine.Never mind that you’ve bought these assets with money that’s already been taxed. Now they want to tax it again, every year. And when you die they want to tax it again.They even included Individual Retirement Accounts.Hell, for that matter they even proposed taxing “household goods” beyond a certain threshold. So you could even pay tax on your toaster oven.What I found really interesting about this proposal, though, is that the guy who authored it is NOT one of the 10,000 people running for President right now.In fact, this US Senator (Ron Wyden from Oregon) isn’t even up for re-election until 2022, at which point he’ll likely retire.We’d expect to hear about wealth taxes from all the Bolshevik presidential candidates who are seeking attention and headlines. Or from some firebrand Twitter Queen who hates rich people.But Ron Wyden is neither of those. He’s a seasoned, 70-year old US Senator who created a detailed 33-page plan on why AND how to implement a wealth tax.This shows that the idea is really catching fire.The wealth tax, of course, joins a slew of other taxes and hikes that have been proposed by the motley gang of Bolsheviks.Several candidates plan to drastically raise the Death Tax while slashing exemptions. Others want to raise the top income tax rate to 70%. Another wants to tax UNREALIZED (i.e. paper) gains on investments.They always say, of course, that they only want to tax the wealthy. They might even mean it.But take a look at the income tax itself as a great historical example.When the income tax was first implemented in 1913, it was intended to affect only the wealthiest households in America. Plus, the base rate was just 1%, and the top rate was 7%.It was only a few years later that the middle class got ensnared into paying taxes. And by 1922, there were FIFTY SIX different tax brackets, all the way up to 73%, with nearly everyone in America owing a ‘fair share’.Point is, whatever they create to tax the rich almost always ends up affecting the middle class.And this latest proposal shows that the idea of a wealth tax has a LOT of momentum.It’s no longer some lofty sound byte. There are detailed plans and real support behind it… which means you might want to strongly consider your own options for a Plan B.For some people, that might even mean picking up and moving. It’s not such a radical concept… people do it all the time, especially state-to-state.Just a few days ago, Billionaire Carl Icahn announced he was moving to Florida to save on New-York’s ever-increasing taxes.He also said that his whole office is moving with him… and that anyone who doesn’t move won’t have a job anymore.And a long list of billionaires have already moved to Florida to take advantage of this including Paul Tudor Jones, David Tepper, Eddie Lampert, etc.But for those who are willing to leave the mainland, there are even better places.Sir John Templeton, one of the first-ever billionaire investors, moved to the Bahamas late in his career. And from his tax savings alone, he was able to increase his charitable donations by an ADDITIONAL $100 million per year.Puerto Rico is one place that offers exceptional tax advantages; investment income and capital gains are taxed at 0%... and corporate tax is just 4%… all in a tropical paradise that’s a 2 hour flight from the US mainland.US citizens don’t even need a passport to move here. Because Puerto Rico is a US territory, moving to PR is no different than moving from New York to Florida.I’ve said it over and over again, but it’s worth repeating-- these incentives won’t last forever.That’s why I insist the time to start strongly considering them and taking action is NOW.If you’re interested in learning more, <a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">you can read our in-depth report on Puerto Rico’s tax incentives.</a>\n\n<a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/6006852361388032/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">Simon Black,\nFounder, </a><a href=\"https://is-tracking-link-api-prod.appspot.com/api/v1/click/4573605601476608/5825820132114432\" target=\"_blank\" rel=\"noreferrer noopener\">SovereignMan.com</a> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/the-bolsheviks-even-want-to-tax-your-toaster-oven/\"}"
    }
  ]
}
2019/09/16 08:04:30
votermrweirdowski
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
weight10000 (100.00%)
Transaction InfoBlock #36466382/Trx 6e3c0b47591798c0c84a42bd8ebaaa428d800872
View Raw JSON Data
{
  "trx_id": "6e3c0b47591798c0c84a42bd8ebaaa428d800872",
  "block": 36466382,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T08:04:30",
  "op": [
    "vote",
    {
      "voter": "mrweirdowski",
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "weight": 10000
    }
  ]
}
2019/09/16 07:59:42
voterwebdeals
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
weight100 (1.00%)
Transaction InfoBlock #36466286/Trx a89ada5ac6c077d59a49104c79590c0a058430fb
View Raw JSON Data
{
  "trx_id": "a89ada5ac6c077d59a49104c79590c0a058430fb",
  "block": 36466286,
  "trx_in_block": 1,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T07:59:42",
  "op": [
    "vote",
    {
      "voter": "webdeals",
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "weight": 100
    }
  ]
}
2019/09/16 07:56:00
votertotalrehash
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
weight10000 (100.00%)
Transaction InfoBlock #36466213/Trx 570dbaf6c7f50a92a9478b3d7438012fedfc7453
View Raw JSON Data
{
  "trx_id": "570dbaf6c7f50a92a9478b3d7438012fedfc7453",
  "block": 36466213,
  "trx_in_block": 10,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T07:56:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "weight": 10000
    }
  ]
}
2019/09/16 07:51:39
voterlaissez-faire
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
weight10000 (100.00%)
Transaction InfoBlock #36466126/Trx 90971087c9e18277cc507e03b8427bd59f599e14
View Raw JSON Data
{
  "trx_id": "90971087c9e18277cc507e03b8427bd59f599e14",
  "block": 36466126,
  "trx_in_block": 9,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T07:51:39",
  "op": [
    "vote",
    {
      "voter": "laissez-faire",
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "weight": 10000
    }
  ]
}
2019/09/16 07:51:33
voteranomaly
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
weight100 (1.00%)
Transaction InfoBlock #36466124/Trx 2a6fd3f7e634c98eb167e45b600fa788da412740
View Raw JSON Data
{
  "trx_id": "2a6fd3f7e634c98eb167e45b600fa788da412740",
  "block": 36466124,
  "trx_in_block": 0,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T07:51:33",
  "op": [
    "vote",
    {
      "voter": "anomaly",
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "weight": 100
    }
  ]
}
2019/09/16 07:50:39
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36466106/Trx fe63ae12dc03ecbb33b64cf0eb012c555482cf00
View Raw JSON Data
{
  "trx_id": "fe63ae12dc03ecbb33b64cf0eb012c555482cf00",
  "block": 36466106,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T07:50:39",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/16 07:50:39
parent author
parent permlinksteempress
authortotalrehash
permlinkvideomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3
titleVideo: Macaulay Culkin Exposes the "Red Shoe Men" Shoes Made From Sacrifices Of Children
body<img src="https://m.beforeitsnews.com/contributor/upload/106013/images/b6077a2221132d68c492a1fe7363afc6.jpg" alt=""/> <p>“Former child star Macauley Culkin has blown the whistle on the entertainment industry elite to reveal that Hollywood studio executives are ‘blood-thirsty #Satanists’ who ritualistically #murder #child-actors.</p> <p>Videos is below this set of informative picture samples.</p> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_151823_503.jpg" alt="" class="wp-image-23257"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_151847_633.jpg" alt="" class="wp-image-23258"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_151921_265.jpg" alt="" class="wp-image-23259"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_153234_406.jpg" alt="" class="wp-image-23264"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152009_128.jpg" alt="" class="wp-image-23267"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_153305_210.jpg" alt="" class="wp-image-23265"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_153339_973.jpg" alt="" class="wp-image-23266"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152121_760.jpg" alt="" class="wp-image-23269"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152035_909.jpg" alt="" class="wp-image-23268"/> <img src="http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152206_321.jpg" alt="" class="wp-image-23270"/> <p>Video 1</p> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=9Zx3OaK4Mf0 </div> <p>Video 2</p> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=ZcWakOGCJqs </div> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-macaulay-culkin-exposes-the-red-shoe-men-shoes-made-from-sacrifices-of-children/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-macaulay-culkin-exposes-the-red-shoe-men-shoes-made-from-sacrifices-of-children/"}
Transaction InfoBlock #36466106/Trx fe63ae12dc03ecbb33b64cf0eb012c555482cf00
View Raw JSON Data
{
  "trx_id": "fe63ae12dc03ecbb33b64cf0eb012c555482cf00",
  "block": 36466106,
  "trx_in_block": 18,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-16T07:50:39",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videomacaulayculkinexposestheredshoemenshoesmadefromsacrificesofchildren-fklb9o2vi3",
      "title": "Video: Macaulay Culkin Exposes the \"Red Shoe Men\" Shoes Made From Sacrifices Of Children",
      "body": "<img src=\"https://m.beforeitsnews.com/contributor/upload/106013/images/b6077a2221132d68c492a1fe7363afc6.jpg\" alt=\"\"/>\n<p>“Former child star Macauley Culkin has blown the whistle on the  entertainment industry elite to reveal that Hollywood studio executives  are ‘blood-thirsty #Satanists’ who ritualistically #murder #child-actors.</p>\n<p>Videos is below this set of informative picture samples.</p>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_151823_503.jpg\" alt=\"\" class=\"wp-image-23257\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_151847_633.jpg\" alt=\"\" class=\"wp-image-23258\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_151921_265.jpg\" alt=\"\" class=\"wp-image-23259\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_153234_406.jpg\" alt=\"\" class=\"wp-image-23264\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152009_128.jpg\" alt=\"\" class=\"wp-image-23267\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_153305_210.jpg\" alt=\"\" class=\"wp-image-23265\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_153339_973.jpg\" alt=\"\" class=\"wp-image-23266\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152121_760.jpg\" alt=\"\" class=\"wp-image-23269\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152035_909.jpg\" alt=\"\" class=\"wp-image-23268\"/>\n<img src=\"http://totalrehash.com/wp-content/uploads/2019/09/IMG_20190916_152206_321.jpg\" alt=\"\" class=\"wp-image-23270\"/>\n<p>Video 1</p>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=9Zx3OaK4Mf0\n</div>\n<p>Video 2</p>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=ZcWakOGCJqs\n</div>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-macaulay-culkin-exposes-the-red-shoe-men-shoes-made-from-sacrifices-of-children/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-macaulay-culkin-exposes-the-red-shoe-men-shoes-made-from-sacrifices-of-children/\"}"
    }
  ]
}
2019/09/15 11:49:00
votertotalrehash
authortotalrehash
permlinkvideothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1
weight10000 (100.00%)
Transaction InfoBlock #36442124/Trx 85fd8555524e418be5f563572a51a3628d8643ea
View Raw JSON Data
{
  "trx_id": "85fd8555524e418be5f563572a51a3628d8643ea",
  "block": 36442124,
  "trx_in_block": 19,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T11:49:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1",
      "weight": 10000
    }
  ]
}
2019/09/15 11:43:51
votersteeming-hot
authortotalrehash
permlinkvideothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1
weight1 (0.01%)
Transaction InfoBlock #36442021/Trx 3ee187920fece05534f72d3615a18e9b52511fa1
View Raw JSON Data
{
  "trx_id": "3ee187920fece05534f72d3615a18e9b52511fa1",
  "block": 36442021,
  "trx_in_block": 16,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T11:43:51",
  "op": [
    "vote",
    {
      "voter": "steeming-hot",
      "author": "totalrehash",
      "permlink": "videothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1",
      "weight": 1
    }
  ]
}
2019/09/15 11:43:21
authortotalrehash
permlinkvideothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36442011/Trx ff1266e2a33bf77b4a0d19ca88e51f8de97b5d39
View Raw JSON Data
{
  "trx_id": "ff1266e2a33bf77b4a0d19ca88e51f8de97b5d39",
  "block": 36442011,
  "trx_in_block": 14,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T11:43:21",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/15 11:43:21
parent author
parent permlinksteempress
authortotalrehash
permlinkvideothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1
titleVideo: The Deep State /Talmudic Satanist Illuminati Are About to Make Their Final Move For Zion
body<p>They've been planning this since the beginning of time! #talmudic #satan #deep #state #ww3</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=YrhejY6HXyg </div></figure> <p>MAIN CHANNEL HERE - <a href="https://m.youtube.com/watch?v=k2miY7PU_L8">https://www.youtube.com/watch?v=k2miY...</a> Thanks for watching!</p> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-deep-state-talmudic-satanist-illuminati-are-about-to-make-their-final-move-for-zion/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-the-deep-state-talmudic-satanist-illuminati-are-about-to-make-their-final-move-for-zion/"}
Transaction InfoBlock #36442011/Trx ff1266e2a33bf77b4a0d19ca88e51f8de97b5d39
View Raw JSON Data
{
  "trx_id": "ff1266e2a33bf77b4a0d19ca88e51f8de97b5d39",
  "block": 36442011,
  "trx_in_block": 14,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T11:43:21",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videothedeepstatetalmudicsatanistilluminatiareabouttomaketheirfinalmoveforzion-gtgxey27y1",
      "title": "Video: The Deep State /Talmudic Satanist Illuminati Are About to Make Their Final Move For Zion",
      "body": "<p>They've been planning this since the beginning of time! #talmudic #satan #deep #state #ww3</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=YrhejY6HXyg\n</div></figure>\n<p>MAIN CHANNEL HERE - <a href=\"https://m.youtube.com/watch?v=k2miY7PU_L8\">https://www.youtube.com/watch?v=k2miY...</a> Thanks for watching!</p>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-deep-state-talmudic-satanist-illuminati-are-about-to-make-their-final-move-for-zion/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-the-deep-state-talmudic-satanist-illuminati-are-about-to-make-their-final-move-for-zion/\"}"
    }
  ]
}
2019/09/15 06:39:00
votertotalrehash
authortotalrehash
permlinktest-14kfj7nlj4
weight10000 (100.00%)
Transaction InfoBlock #36435934/Trx 96a7fdc7d27877b309f6d1aad6abd96cbe3fb5af
View Raw JSON Data
{
  "trx_id": "96a7fdc7d27877b309f6d1aad6abd96cbe3fb5af",
  "block": 36435934,
  "trx_in_block": 20,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T06:39:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "test-14kfj7nlj4",
      "weight": 10000
    }
  ]
}
totalrehashupdated options for test-14kfj7nlj4
2019/09/15 06:32:57
authortotalrehash
permlinktest-14kfj7nlj4
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36435814/Trx 8b04585c761d9b44df6510c3006c864bd0dc52a3
View Raw JSON Data
{
  "trx_id": "8b04585c761d9b44df6510c3006c864bd0dc52a3",
  "block": 36435814,
  "trx_in_block": 28,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T06:32:57",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "test-14kfj7nlj4",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
totalrehashpublished a new post: test-14kfj7nlj4
2019/09/15 06:32:57
parent author
parent permlinksteempress
authortotalrehash
permlinktest-14kfj7nlj4
titleTest
body<p>Just a test.</p> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/test/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/test/"}
Transaction InfoBlock #36435814/Trx 8b04585c761d9b44df6510c3006c864bd0dc52a3
View Raw JSON Data
{
  "trx_id": "8b04585c761d9b44df6510c3006c864bd0dc52a3",
  "block": 36435814,
  "trx_in_block": 28,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-15T06:32:57",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "test-14kfj7nlj4",
      "title": "Test",
      "body": "<p>Just a test.</p>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/test/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/test/\"}"
    }
  ]
}
2019/09/14 21:19:00
votertotalrehash
authortotalrehash
permlinkshipcarryingclimatechangewarriorsconcernedaboutmeltingarcticicegetsstuckinice-5kq3b9zwhk
weight10000 (100.00%)
Transaction InfoBlock #36424761/Trx 4f0a6066e4e1104872217e80c15a25cc0f7eab24
View Raw JSON Data
{
  "trx_id": "4f0a6066e4e1104872217e80c15a25cc0f7eab24",
  "block": 36424761,
  "trx_in_block": 19,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T21:19:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "shipcarryingclimatechangewarriorsconcernedaboutmeltingarcticicegetsstuckinice-5kq3b9zwhk",
      "weight": 10000
    }
  ]
}
2019/09/14 21:13:48
authortotalrehash
permlinkshipcarryingclimatechangewarriorsconcernedaboutmeltingarcticicegetsstuckinice-5kq3b9zwhk
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36424658/Trx 4a34a782f8272c360001eceec6c175f5ccf687fa
View Raw JSON Data
{
  "trx_id": "4a34a782f8272c360001eceec6c175f5ccf687fa",
  "block": 36424658,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T21:13:48",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "shipcarryingclimatechangewarriorsconcernedaboutmeltingarcticicegetsstuckinice-5kq3b9zwhk",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/14 21:13:48
parent author
parent permlinksteempress
authortotalrehash
permlinkshipcarryingclimatechangewarriorsconcernedaboutmeltingarcticicegetsstuckinice-5kq3b9zwhk
titleShip Carrying ‘Climate Change Warriors’ Concerned About Melting Arctic Ice Gets Stuck in Ice
body<p><strong>A ship carrying passengers who included a group of ‘#Climate #Change Warriors’ who are concerned about melting #Arctic ice got #stuck in the ice halfway between Norway and the North Pole.</strong></p> <p>Oh, the irony.</p> <p>“Arctic tours ship MS MALMO with 16 passengers on board got stuck in ice on Sep 3 off Longyearbyen, Svalbard Archipelago,” reports the&nbsp;<a href="https://maritimebulletin.net/2019/09/04/ship-with-climate-change-warriors-caught-in-ice-warriors-evacuated/?via=">Maritime Bulletin</a>. “The ship is on Arctic tour with Climate Change documentary film team, and tourists, concerned with Climate Change and melting Arctic ice.”</p> <p>The passengers were safely evacuated by helicopter.</p> <p>“Something is very wrong with Arctic ice, instead of melting as ordered by UN/IPCC, it captured the ship with Climate Change Warriors,” joked Erofey Schkvarkin.</p> <p>The story is similar to a 2014 incident when a Chinese icebreaker had to be sent to rescue dozens of global warming researchers and environmentalists who got stranded on a ship which got stuck in the Antarctic ice.</p> <p>Poster child environmentalist Greta Thunberg has not commented on the latest incident.</p> <figure><iframe src="https://www.bitchute.com/embed/qpSQuc69R9c" allowfullscreen="allowfullscreen" width="640" height="360"></iframe></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/ship-carrying-climate-change-warriors-concerned-about-melting-arctic-ice-gets-stuck-in-ice/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/ship-carrying-climate-change-warriors-concerned-about-melting-arctic-ice-gets-stuck-in-ice/"}
Transaction InfoBlock #36424658/Trx 4a34a782f8272c360001eceec6c175f5ccf687fa
View Raw JSON Data
{
  "trx_id": "4a34a782f8272c360001eceec6c175f5ccf687fa",
  "block": 36424658,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T21:13:48",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "shipcarryingclimatechangewarriorsconcernedaboutmeltingarcticicegetsstuckinice-5kq3b9zwhk",
      "title": "Ship Carrying ‘Climate Change Warriors’ Concerned About Melting Arctic Ice Gets Stuck in Ice",
      "body": "<p><strong>A ship carrying passengers who included a group of ‘#Climate  #Change Warriors’ who are concerned about melting #Arctic ice got #stuck in  the ice halfway between Norway and the North Pole.</strong></p>\n<p>Oh, the irony.</p>\n<p>“Arctic tours ship MS MALMO with 16 passengers on board got stuck in \nice on Sep 3 off Longyearbyen, Svalbard Archipelago,” reports the&nbsp;<a href=\"https://maritimebulletin.net/2019/09/04/ship-with-climate-change-warriors-caught-in-ice-warriors-evacuated/?via=\">Maritime Bulletin</a>.\n “The ship is on Arctic tour with Climate Change documentary film team, \nand tourists, concerned with Climate Change and melting Arctic ice.”</p>\n<p>The passengers were safely evacuated by helicopter.</p>\n<p>“Something is very wrong with Arctic ice, instead of melting as \nordered by UN/IPCC, it captured the ship with Climate Change Warriors,” \njoked Erofey Schkvarkin.</p>\n<p>The story is similar to a 2014 incident when a Chinese icebreaker had\n to be sent to rescue dozens of global warming researchers and \nenvironmentalists who got stranded on a ship which got stuck in the \nAntarctic ice.</p>\n<p>Poster child environmentalist Greta Thunberg has not commented on the latest incident.</p>\n<figure><iframe src=\"https://www.bitchute.com/embed/qpSQuc69R9c\" allowfullscreen=\"allowfullscreen\" width=\"640\" height=\"360\"></iframe></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/ship-carrying-climate-change-warriors-concerned-about-melting-arctic-ice-gets-stuck-in-ice/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/ship-carrying-climate-change-warriors-concerned-about-melting-arctic-ice-gets-stuck-in-ice/\"}"
    }
  ]
}
2019/09/14 19:20:12
votersteemitboard
authortotalrehash
permlinkthegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9
weight100 (1.00%)
Transaction InfoBlock #36422390/Trx efb7d1d1e67e0ad3631286c3da47c5f5bd22857a
View Raw JSON Data
{
  "trx_id": "efb7d1d1e67e0ad3631286c3da47c5f5bd22857a",
  "block": 36422390,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T19:20:12",
  "op": [
    "vote",
    {
      "voter": "steemitboard",
      "author": "totalrehash",
      "permlink": "thegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9",
      "weight": 100
    }
  ]
}
2019/09/14 19:20:09
parent authortotalrehash
parent permlinkthegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9
authorsteemitboard
permlinksteemitboard-notify-totalrehash-20190914t192008000z
title
bodyCongratulations @totalrehash! You have completed the following achievement on the Steem blockchain and have been rewarded with new badge(s) : <table><tr><td><img src="https://steemitimages.com/60x70/http://steemitboard.com/@totalrehash/posts.png?201909141844"></td><td>You published more than 60 posts. Your next target is to reach 70 posts.</td></tr> </table> <sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@totalrehash) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=totalrehash)_</sub> <sub>_If you no longer want to receive notifications, reply to this comment with the word_ `STOP`</sub> To support your work, I also upvoted your post! ###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!
json metadata{"image":["https://steemitboard.com/img/notify.png"]}
Transaction InfoBlock #36422389/Trx 656fc8d99755441399ff42ceaf52e11b79a69b50
View Raw JSON Data
{
  "trx_id": "656fc8d99755441399ff42ceaf52e11b79a69b50",
  "block": 36422389,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T19:20:09",
  "op": [
    "comment",
    {
      "parent_author": "totalrehash",
      "parent_permlink": "thegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9",
      "author": "steemitboard",
      "permlink": "steemitboard-notify-totalrehash-20190914t192008000z",
      "title": "",
      "body": "Congratulations @totalrehash! You have completed the following achievement on the Steem blockchain and have been rewarded with new badge(s) :\n\n<table><tr><td><img src=\"https://steemitimages.com/60x70/http://steemitboard.com/@totalrehash/posts.png?201909141844\"></td><td>You published more than 60 posts. Your next target is to reach 70 posts.</td></tr>\n</table>\n\n<sub>_You can view [your badges on your Steem Board](https://steemitboard.com/@totalrehash) and compare to others on the [Steem Ranking](https://steemitboard.com/ranking/index.php?name=totalrehash)_</sub>\n<sub>_If you no longer want to receive notifications, reply to this comment with the word_ `STOP`</sub>\n\n\nTo support your work, I also upvoted your post!\n\n\n###### [Vote for @Steemitboard as a witness](https://v2.steemconnect.com/sign/account-witness-vote?witness=steemitboard&approve=1) to get one more award and increased upvotes!",
      "json_metadata": "{\"image\":[\"https://steemitboard.com/img/notify.png\"]}"
    }
  ]
}
2019/09/14 16:05:03
votertotalrehash
authortotalrehash
permlinkthegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9
weight10000 (100.00%)
Transaction InfoBlock #36418498/Trx 70a143a1672f2bc9105377791d3761cc6a70ca3a
View Raw JSON Data
{
  "trx_id": "70a143a1672f2bc9105377791d3761cc6a70ca3a",
  "block": 36418498,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T16:05:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "thegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9",
      "weight": 10000
    }
  ]
}
2019/09/14 15:59:54
authortotalrehash
permlinkthegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36418395/Trx 8b643725c949537203be2d37c5b64a2c42e3c624
View Raw JSON Data
{
  "trx_id": "8b643725c949537203be2d37c5b64a2c42e3c624",
  "block": 36418395,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T15:59:54",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "thegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/14 15:59:54
parent author
parent permlinksteempress
authortotalrehash
permlinkthegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9
titleThe Green's Go Soylent Green: Eating human flesh is the latest idea to stop climate chang
body<p>Climate change alarmism has taken a macabre turn that looks like satire, but isn’t.</p> <p>It happened in <a href="https://m.theepochtimes.com/t-sweden">Sweden</a>.</p> <p>At a summit for food of the future (the climate-ravaged future) called Gastro Summit, in Stockholm on Sept. 3 to 4, a professor held a PowerPoint presentation asserting that we must “awaken the idea” of eating human flesh in the future, as a way of combating the effects of climate change.</p> <p>In a talk titled “Can You Imagine Eating Human Flesh?”, behavioral scientist and marketing strategist Magnus Soderlund from the Stockholm School of Economics argued for the breaking down of ancient taboos against desecrating the human corpse and eating human flesh.</p> <center><img src="https://img.theepochtimes.com/assets/uploads/2019/09/04/15c152692ef92d3d_ttl7dayjvx_Screen_Shot_2019-09-04_at_3.16.56_PM_copy-700x420.jpg" alt=""/><br/><i>A screenshot from a T.V. program in which behavioral scientist </i></center> <p>He refers to the taboos against it as “conservative” and discusses people’s resistance to it as a problem that could be overcome, little by little, beginning with persuading people to just taste it. He can be seen in his video presentation and on Swedish channel TV4 saying that since food sources will be scarce in the future, people must be introduced to eating things they have thus far considered disgusting—among them, human flesh.</p> <p>Easier sells he suggests include pets and insects, but human flesh was the central topic. In Swedish articles describing this new debate, the term “mannisko-kotts branschen” is introduced. This means “the human flesh industry.”</p> <p>In his bio at the Stockholm School of Economics, Soderlund states that his research focus includes&nbsp; “consumer behavior,” “marketing stimuli,” “loyalty, emotions, justice perceptions,” “psychological reactions,” and “in a society increasingly obsessed with consumption.”</p> <p>People can be “tricked,” Soderlund teases, into “making the right decisions.”</p> <p>Conflating resistance to eating human flesh with capitalist selfishness, the seminar’s talking points ask:</p> <p>“Are we humans too selfish to live sustainably?</p> <p>“Is cannibalism the solution to food sustainability in the future? Does Generation Z have the answers to our food challenges? Can consumers be tricked into making the right decisions? At GastroSummit, you will get some answers to these questions—and also partake in the latest scientific findings and get to meet the leading experts.”</p> <p>In his talk, Soderlund&nbsp;asks the audience how many would be open to the idea. Not many hands go up. Some groaning is heard. When interviewed after his talk, he reports brightly that 8 percent of conference participants said they would be open to trying it. When asked if he himself would try it, he replies, “I feel somewhat hesitant but to not appear overly conservative … I’d have to say … I’d be open to at least tasting it.”</p> <p>The logo for the talk, titled “Food of the Future: Worms, Grasshoppers, or Human Flesh,” features a splash of blood as part of the graphic design.</p> <p>What Soderlund doesn’t mention, curiously, is the long documented science on the biological effects of cannibalism.</p> <p>A tribe called the Fore lived in isolation in Papua New Guinea until the 1930s. They believed in eating their dead, rather than allowing them to be consumed by worms. This led to <a href="https://www.esquire.com/lifestyle/health/news/a48393/sick-eating-human-meat/">an epidem</a>ic of a disease called “kuru,” or “the laughing death,” caused by ingestion of human flesh. This disease wasn’t caused by a pathogen, but rather, a “twisted protein” (according to an <a href="https://www.npr.org/sections/thesalt/2016/09/06/482952588/when-people-ate-people-a-strange-disease-emerged">NPR report</a>) that tricks other proteins in the brain to twist like it, damaging the brain’s cerebellum. Researchers compared it to Dr. Jekyll’s transformation. The last victim of kuru died in 2009.</p> <p>Whoever is in charge of Sweden’s public relations is doing an abysmal job. That’s unless the new brand is that this small Northern country—obsessed with atheism and political correctness—is now cooler than ever for resetting all previously known boundaries of “noir.”</p> <p>And madness.</p> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-greens-go-soylent-green-eating-human-flesh-is-the-latest-idea-to-stop-climate-chang/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/the-greens-go-soylent-green-eating-human-flesh-is-the-latest-idea-to-stop-climate-chang/"}
Transaction InfoBlock #36418395/Trx 8b643725c949537203be2d37c5b64a2c42e3c624
View Raw JSON Data
{
  "trx_id": "8b643725c949537203be2d37c5b64a2c42e3c624",
  "block": 36418395,
  "trx_in_block": 2,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T15:59:54",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "thegreensgosoylentgreeneatinghumanfleshisthelatestideatostopclimatechang-kwbu35haq9",
      "title": "The Green's Go Soylent Green: Eating human flesh is the latest idea to stop climate chang",
      "body": "<p>Climate change alarmism has taken a macabre turn that looks like satire, but isn’t.</p>\n<p>It happened in <a href=\"https://m.theepochtimes.com/t-sweden\">Sweden</a>.</p>\n<p>At a summit for food of the future (the climate-ravaged future) \ncalled Gastro Summit, in Stockholm on Sept. 3 to 4, a professor held a \nPowerPoint presentation asserting that we must “awaken the idea” of \neating human flesh in the future, as a way of combating the effects of \nclimate change.</p>\n<p>In a talk titled “Can You Imagine Eating Human Flesh?”, behavioral  scientist and marketing strategist Magnus Soderlund from the Stockholm  School of Economics argued for the breaking down of ancient taboos  against desecrating the human corpse and eating human flesh.</p>\n<center><img src=\"https://img.theepochtimes.com/assets/uploads/2019/09/04/15c152692ef92d3d_ttl7dayjvx_Screen_Shot_2019-09-04_at_3.16.56_PM_copy-700x420.jpg\" alt=\"\"/><br/><i>A screenshot from a T.V. program in which behavioral scientist </i></center>\n\n<p>He refers to the taboos against it as “conservative” and discusses \npeople’s resistance to it as a problem that could be overcome, little by\n little, beginning with persuading people to just taste it. He can be \nseen in his video presentation and on Swedish channel TV4 saying that \nsince food sources will be scarce in the future, people must be \nintroduced to eating things they have thus far considered \ndisgusting—among them, human flesh.</p>\n<p>Easier sells he suggests include pets and insects, but human flesh \nwas the central topic. In Swedish articles describing this new debate, \nthe term “mannisko-kotts branschen” is introduced. This means “the human\n flesh industry.”</p>\n<p>In his bio at the Stockholm School of Economics, Soderlund states \nthat his research focus includes&nbsp; “consumer behavior,” “marketing \nstimuli,” “loyalty, emotions, justice perceptions,” “psychological \nreactions,” and “in a society increasingly obsessed with consumption.”</p>\n<p>People can be “tricked,” Soderlund teases, into “making the right decisions.”</p>\n<p>Conflating resistance to eating human flesh with capitalist selfishness, the seminar’s talking points ask:</p>\n<p>“Are we humans too selfish to live sustainably?</p>\n<p>“Is cannibalism the solution to food sustainability in the future? \nDoes Generation Z have the answers to our food challenges? Can consumers\n be tricked into making the right decisions? At GastroSummit, you will \nget some answers to these questions—and also partake in the latest \nscientific findings and get to meet the leading experts.”</p>\n<p>In his talk, Soderlund&nbsp;asks the audience how many would be open to \nthe idea. Not many hands go up. Some groaning is heard. When interviewed\n after his talk, he reports brightly that 8 percent of conference \nparticipants said they would be open to trying it. When asked if he \nhimself would try it, he replies, “I feel somewhat hesitant but to not \nappear overly conservative … I’d have to say … I’d be open to at least \ntasting it.”</p>\n<p>The logo for the talk, titled “Food of the Future: Worms, \nGrasshoppers, or Human Flesh,” features a splash of blood as part of the\n graphic design.</p>\n<p>What Soderlund doesn’t mention, curiously, is the long documented science on the biological effects of cannibalism.</p>\n<p>A tribe called the Fore lived in isolation in Papua New Guinea until \nthe 1930s. They believed in eating their dead, rather than allowing them\n to be consumed by worms. This led to <a href=\"https://www.esquire.com/lifestyle/health/news/a48393/sick-eating-human-meat/\">an epidem</a>ic\n of a disease called “kuru,” or “the laughing death,” caused by \ningestion of human flesh. This disease wasn’t caused by a pathogen, but \nrather, a “twisted protein” (according to an <a href=\"https://www.npr.org/sections/thesalt/2016/09/06/482952588/when-people-ate-people-a-strange-disease-emerged\">NPR report</a>)\n that tricks other proteins in the brain to twist like it, damaging the \nbrain’s cerebellum. Researchers compared it to Dr. Jekyll’s \ntransformation. The last victim of kuru died in 2009.</p>\n<p>Whoever is in charge of Sweden’s public relations is doing an abysmal\n job. That’s unless the new brand is that this small Northern \ncountry—obsessed with atheism and political correctness—is now cooler \nthan ever for resetting all previously known boundaries of “noir.”</p>\n<p>And madness.</p>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/the-greens-go-soylent-green-eating-human-flesh-is-the-latest-idea-to-stop-climate-chang/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/the-greens-go-soylent-green-eating-human-flesh-is-the-latest-idea-to-stop-climate-chang/\"}"
    }
  ]
}
2019/09/14 15:55:03
votertotalrehash
authortotalrehash
permlinkvideostevequaylepreparingtofightunderstandingwhatscoming-z0dx0zd9p6
weight10000 (100.00%)
Transaction InfoBlock #36418299/Trx 0e1015324e61557def4d73892e87599f4fd21a1a
View Raw JSON Data
{
  "trx_id": "0e1015324e61557def4d73892e87599f4fd21a1a",
  "block": 36418299,
  "trx_in_block": 4,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T15:55:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videostevequaylepreparingtofightunderstandingwhatscoming-z0dx0zd9p6",
      "weight": 10000
    }
  ]
}
2019/09/14 15:49:00
authortotalrehash
permlinkvideostevequaylepreparingtofightunderstandingwhatscoming-z0dx0zd9p6
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36418178/Trx c655e26de077004df4d20192e99cad244829fccf
View Raw JSON Data
{
  "trx_id": "c655e26de077004df4d20192e99cad244829fccf",
  "block": 36418178,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T15:49:00",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videostevequaylepreparingtofightunderstandingwhatscoming-z0dx0zd9p6",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/14 15:49:00
parent author
parent permlinksteempress
authortotalrehash
permlinkvideostevequaylepreparingtofightunderstandingwhatscoming-z0dx0zd9p6
titleVideo: Steve Quayle: Preparing to Fight & Understanding What's Coming
body<img src="http://m.beforeitsnews.com/contributor/upload/106013/images/0(4).jpg" alt=""/> <p>I keep hearing WHAT we are to do but not HOW. I have nothing in and of myself that can accomplish what is needed. #Christ in me is the hope of glory; leaning more and more on Him to be what He wants me to be. Prov 3:5:6</p> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=LZLWdsd4UYk </div> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-steve-quayle-preparing-to-fight-understanding-whats-coming/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-steve-quayle-preparing-to-fight-understanding-whats-coming/"}
Transaction InfoBlock #36418178/Trx c655e26de077004df4d20192e99cad244829fccf
View Raw JSON Data
{
  "trx_id": "c655e26de077004df4d20192e99cad244829fccf",
  "block": 36418178,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-14T15:49:00",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videostevequaylepreparingtofightunderstandingwhatscoming-z0dx0zd9p6",
      "title": "Video: Steve Quayle: Preparing to Fight & Understanding What's Coming",
      "body": "<img src=\"http://m.beforeitsnews.com/contributor/upload/106013/images/0(4).jpg\" alt=\"\"/>\n<p>I keep hearing WHAT we are to do but not HOW. I have nothing in and  of myself that can accomplish what is needed. #Christ in me is the hope  of glory; leaning more and more on Him to be what He wants me to be.  Prov 3:5:6</p>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=LZLWdsd4UYk\n</div>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-steve-quayle-preparing-to-fight-understanding-whats-coming/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-steve-quayle-preparing-to-fight-understanding-whats-coming/\"}"
    }
  ]
}
2019/09/13 13:49:00
votertotalrehash
authortotalrehash
permlinkvideomarktaylortrumpralliesborderchaosgovtmoremostshockingpredictionof2019-oq966rb7hl
weight10000 (100.00%)
Transaction InfoBlock #36387047/Trx 159dadfcd2f0fbf3a2aa512a361e450fbe82fb26
View Raw JSON Data
{
  "trx_id": "159dadfcd2f0fbf3a2aa512a361e450fbe82fb26",
  "block": 36387047,
  "trx_in_block": 29,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T13:49:00",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videomarktaylortrumpralliesborderchaosgovtmoremostshockingpredictionof2019-oq966rb7hl",
      "weight": 10000
    }
  ]
}
2019/09/13 13:42:57
authortotalrehash
permlinkvideomarktaylortrumpralliesborderchaosgovtmoremostshockingpredictionof2019-oq966rb7hl
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36386926/Trx e5702a7d1de4b3cf070e430c19dc5feaf535241d
View Raw JSON Data
{
  "trx_id": "e5702a7d1de4b3cf070e430c19dc5feaf535241d",
  "block": 36386926,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T13:42:57",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videomarktaylortrumpralliesborderchaosgovtmoremostshockingpredictionof2019-oq966rb7hl",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/13 13:42:57
parent author
parent permlinksteempress
authortotalrehash
permlinkvideomarktaylortrumpralliesborderchaosgovtmoremostshockingpredictionof2019-oq966rb7hl
titleVideo: Mark Taylor: Trump Rallies / Border Chaos / Gov't & More / Most Shocking Prediction of 2019
body<img src="https://beforeitsnews.com/contributor/upload/106013/images/proxy_duckduckgo_com(1026).jpg" alt=""/> <p>In November of 2016, the world witnessed the impossible. Nearly every household in America was tuned in to the election feeds, and every update pointed to a loss for the Republican Party. But when the map of the states flipped red in the final hour, there were a select few who weren’t surprised. They had always known Trump was going to win. He was chosen for such a time as this. The prophecy had said so.</p> <p>This prophet, this reserved man of God, was retired firefighter Mark Taylor. The word given by the Holy Spirit was delivered on April 28, 2011, years before Trump’s victory. The election, however, was only the beginning.</p> <p>In this UPDATED AND EXPANDED release of The Trump Prophecies.</p> <p>Defender Publishing revisits what the Lord revealed to Mark Taylor in both the celebrated “Commander-In-Chief Prophecy” that played such a key role in bolstering Trump’s 2016 win, as well as many other messages the Holy Spirit inspired Taylor to write about what would transpire next for the most powerful nation on earth today.</p> <p>Mark Taylor Twitter <a rel="noreferrer noopener" target="_blank" href="https://www.youtube.com/redirect?redir_token=JZSU3OQUJVyiADgcIzj1I0P5zIh8MTU2ODQ2ODE1NEAxNTY4MzgxNzU0&amp;q=https%3A%2F%2Ftwitter.com%2Fpatton6966&amp;v=xrPAqp6poyk&amp;event=video_description">https://twitter.com/patton6966</a></p> <p>Https<a rel="noreferrer noopener" target="_blank" href="https://www.youtube.com/redirect?redir_token=JZSU3OQUJVyiADgcIzj1I0P5zIh8MTU2ODQ2ODE1NEAxNTY4MzgxNzU0&amp;q=https%3A%2F%2Fwww.patreon.com%2Fcurrency365&amp;v=xrPAqp6poyk&amp;event=video_description">://www.patreon.com/currency365</a></p> <p>Https<a rel="noreferrer noopener" target="_blank" href="https://www.youtube.com/redirect?redir_token=JZSU3OQUJVyiADgcIzj1I0P5zIh8MTU2ODQ2ODE1NEAxNTY4MzgxNzU0&amp;q=https%3A%2F%2Fwww.patreon.com%2Feyesopenmedia&amp;v=xrPAqp6poyk&amp;event=video_description">://www.patreon.com/</a>eyesopenmedia</p> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=xrPAqp6poyk </div> <p>Most Shocking Prediction of 2019</p> <div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?v=5QdNPQkM6I8 </div> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-mark-taylor-trump-rallies-border-chaos-govt-more-most-shocking-prediction-of-2019/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-mark-taylor-trump-rallies-border-chaos-govt-more-most-shocking-prediction-of-2019/"}
Transaction InfoBlock #36386926/Trx e5702a7d1de4b3cf070e430c19dc5feaf535241d
View Raw JSON Data
{
  "trx_id": "e5702a7d1de4b3cf070e430c19dc5feaf535241d",
  "block": 36386926,
  "trx_in_block": 23,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T13:42:57",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videomarktaylortrumpralliesborderchaosgovtmoremostshockingpredictionof2019-oq966rb7hl",
      "title": "Video: Mark Taylor: Trump Rallies / Border Chaos / Gov't & More / Most Shocking Prediction of 2019",
      "body": "<img src=\"https://beforeitsnews.com/contributor/upload/106013/images/proxy_duckduckgo_com(1026).jpg\" alt=\"\"/>\n<p>In November of 2016, the world witnessed the impossible. Nearly every\n household in America was tuned in to the election feeds, and every \nupdate pointed to a loss for the Republican Party. But when the map of \nthe states flipped red in the final hour, there were a select few who \nweren’t surprised. They had always known Trump was going to win. He was \nchosen for such a time as this. The prophecy had said so.</p>\n<p>This prophet, this reserved man of God, was retired firefighter Mark \nTaylor. The word given by the Holy Spirit was delivered on April 28, \n2011, years before Trump’s victory. The election, however, was only the \nbeginning.</p>\n<p>In this UPDATED AND EXPANDED release of The Trump Prophecies.</p>\n<p>Defender Publishing revisits what the Lord revealed to Mark Taylor in  both the celebrated “Commander-In-Chief Prophecy” that played such a  key role in bolstering Trump’s 2016 win, as well as many other messages  the Holy Spirit inspired Taylor to write about what would transpire next  for the most powerful nation on earth today.</p>\n<p>Mark Taylor Twitter <a rel=\"noreferrer noopener\" target=\"_blank\" href=\"https://www.youtube.com/redirect?redir_token=JZSU3OQUJVyiADgcIzj1I0P5zIh8MTU2ODQ2ODE1NEAxNTY4MzgxNzU0&amp;q=https%3A%2F%2Ftwitter.com%2Fpatton6966&amp;v=xrPAqp6poyk&amp;event=video_description\">https://twitter.com/patton6966</a></p>\n<p>Https<a rel=\"noreferrer noopener\" target=\"_blank\" href=\"https://www.youtube.com/redirect?redir_token=JZSU3OQUJVyiADgcIzj1I0P5zIh8MTU2ODQ2ODE1NEAxNTY4MzgxNzU0&amp;q=https%3A%2F%2Fwww.patreon.com%2Fcurrency365&amp;v=xrPAqp6poyk&amp;event=video_description\">://www.patreon.com/currency365</a></p>\n<p>Https<a rel=\"noreferrer noopener\" target=\"_blank\" href=\"https://www.youtube.com/redirect?redir_token=JZSU3OQUJVyiADgcIzj1I0P5zIh8MTU2ODQ2ODE1NEAxNTY4MzgxNzU0&amp;q=https%3A%2F%2Fwww.patreon.com%2Feyesopenmedia&amp;v=xrPAqp6poyk&amp;event=video_description\">://www.patreon.com/</a>eyesopenmedia</p>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=xrPAqp6poyk\n</div>\n<p>Most Shocking Prediction of 2019</p>\n<div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?v=5QdNPQkM6I8\n</div>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-mark-taylor-trump-rallies-border-chaos-govt-more-most-shocking-prediction-of-2019/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-mark-taylor-trump-rallies-border-chaos-govt-more-most-shocking-prediction-of-2019/\"}"
    }
  ]
}
2019/09/13 09:05:03
votertotalrehash
authortotalrehash
permlinkvideothebiblemakessense-youwilllovethisguy-throughthebiblewithlesfeldick-yeujfvnsrw
weight10000 (100.00%)
Transaction InfoBlock #36381383/Trx 6d44f35919769d01391d5320418ebc45961869e6
View Raw JSON Data
{
  "trx_id": "6d44f35919769d01391d5320418ebc45961869e6",
  "block": 36381383,
  "trx_in_block": 5,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T09:05:03",
  "op": [
    "vote",
    {
      "voter": "totalrehash",
      "author": "totalrehash",
      "permlink": "videothebiblemakessense-youwilllovethisguy-throughthebiblewithlesfeldick-yeujfvnsrw",
      "weight": 10000
    }
  ]
}
2019/09/13 08:59:42
authortotalrehash
permlinkvideothebiblemakessense-youwilllovethisguy-throughthebiblewithlesfeldick-yeujfvnsrw
max accepted payout1000000.000 SBD
percent steem dollars10000
allow votestrue
allow curation rewardstrue
extensions[[0,{"beneficiaries":[{"account":"steempress","weight":1500}]}]]
Transaction InfoBlock #36381276/Trx af3b826c200028fb402f1f0799b95edd70c95be9
View Raw JSON Data
{
  "trx_id": "af3b826c200028fb402f1f0799b95edd70c95be9",
  "block": 36381276,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T08:59:42",
  "op": [
    "comment_options",
    {
      "author": "totalrehash",
      "permlink": "videothebiblemakessense-youwilllovethisguy-throughthebiblewithlesfeldick-yeujfvnsrw",
      "max_accepted_payout": "1000000.000 SBD",
      "percent_steem_dollars": 10000,
      "allow_votes": true,
      "allow_curation_rewards": true,
      "extensions": [
        [
          0,
          {
            "beneficiaries": [
              {
                "account": "steempress",
                "weight": 1500
              }
            ]
          }
        ]
      ]
    }
  ]
}
2019/09/13 08:59:42
parent author
parent permlinksteempress
authortotalrehash
permlinkvideothebiblemakessense-youwilllovethisguy-throughthebiblewithlesfeldick-yeujfvnsrw
titleVideo: The Bible Makes Sense - You Will Love This Guy - Through the Bible with Les Feldick
body<p>“Study to show thyself approved unto #God, a workman that needeth not to be ashamed, Rightly Dividing (Dispensations)  the Word of #Truth.” – 2 Timothy <a rel="noreferrer noopener" target="_blank" href="http://m.beforeitsnews.com/v3/r2/?url=https://www.youtube.com/watch?v=SD9tosFlCcE&amp;list=PLeBJdQU2p21YslX7VOBnUJJ5L7yhPSQnW#">2:15</a></p> <p>“But without #Faith it is impossible to please him: for he that cometh to God must believe that He Is, and that He Is a Rewarder of them that diligently seek Him.” – Hebrews 11:6</p> <figure class="wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio"><div class="wp-block-embed__wrapper"> https://m.youtube.com/watch?list=PLeBJdQU2p21YslX7VOBnUJJ5L7yhPSQnW&amp;v=SD9tosFlCcE </div></figure> <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-bible-makes-sense-you-will-love-this-guy-through-the-bible-with-les-feldick/ </em><hr/></center>
json metadata{"community":"steempress","app":"steempress","image":[""],"tags":["steempress","blog"],"canonical_url":"http://totalrehash.com/video-the-bible-makes-sense-you-will-love-this-guy-through-the-bible-with-les-feldick/"}
Transaction InfoBlock #36381276/Trx af3b826c200028fb402f1f0799b95edd70c95be9
View Raw JSON Data
{
  "trx_id": "af3b826c200028fb402f1f0799b95edd70c95be9",
  "block": 36381276,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T08:59:42",
  "op": [
    "comment",
    {
      "parent_author": "",
      "parent_permlink": "steempress",
      "author": "totalrehash",
      "permlink": "videothebiblemakessense-youwilllovethisguy-throughthebiblewithlesfeldick-yeujfvnsrw",
      "title": "Video: The Bible Makes Sense - You Will Love This Guy - Through the Bible with Les Feldick",
      "body": "<p>“Study to show thyself approved unto #God, a workman that needeth not  to be ashamed, Rightly Dividing (Dispensations)  the Word of #Truth.” – 2  Timothy <a rel=\"noreferrer noopener\" target=\"_blank\" href=\"http://m.beforeitsnews.com/v3/r2/?url=https://www.youtube.com/watch?v=SD9tosFlCcE&amp;list=PLeBJdQU2p21YslX7VOBnUJJ5L7yhPSQnW#\">2:15</a></p>\n<p>“But without #Faith it is impossible to please him: for he that cometh  to God must believe that He Is, and that He Is a Rewarder of them that  diligently seek Him.” – Hebrews 11:6</p>\n<figure class=\"wp-block-embed-youtube wp-block-embed is-type-video is-provider-youtube wp-embed-aspect-16-9 wp-has-aspect-ratio\"><div class=\"wp-block-embed__wrapper\">\nhttps://m.youtube.com/watch?list=PLeBJdQU2p21YslX7VOBnUJJ5L7yhPSQnW&amp;v=SD9tosFlCcE\n</div></figure>\n <br /><center><hr/><em>Posted from my blog with <a href='https://wordpress.org/plugins/steempress/'>SteemPress</a> : http://totalrehash.com/video-the-bible-makes-sense-you-will-love-this-guy-through-the-bible-with-les-feldick/ </em><hr/></center>           ",
      "json_metadata": "{\"community\":\"steempress\",\"app\":\"steempress\",\"image\":[\"\"],\"tags\":[\"steempress\",\"blog\"],\"canonical_url\":\"http://totalrehash.com/video-the-bible-makes-sense-you-will-love-this-guy-through-the-bible-with-les-feldick/\"}"
    }
  ]
}
2019/09/13 06:56:48
voterlaissez-faire
authortotalrehash
permlinkelectriccarsandthegreenenergymyth-22p5u3fkb6
weight10000 (100.00%)
Transaction InfoBlock #36378822/Trx ef5382f761b48a60b1830db4bb287f043bbc52f9
View Raw JSON Data
{
  "trx_id": "ef5382f761b48a60b1830db4bb287f043bbc52f9",
  "block": 36378822,
  "trx_in_block": 17,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T06:56:48",
  "op": [
    "vote",
    {
      "voter": "laissez-faire",
      "author": "totalrehash",
      "permlink": "electriccarsandthegreenenergymyth-22p5u3fkb6",
      "weight": 10000
    }
  ]
}
2019/09/13 06:47:18
voterlaissez-faire
authortotalrehash
permlinkvideostevequaylealienagendanephiliminterdimensionalportalsantarcticweathercontrolstations-16lczlla2t
weight10000 (100.00%)
Transaction InfoBlock #36378632/Trx 9cb9174f9d55d2969d4fe5cfb61d61ae0eb8fd55
View Raw JSON Data
{
  "trx_id": "9cb9174f9d55d2969d4fe5cfb61d61ae0eb8fd55",
  "block": 36378632,
  "trx_in_block": 19,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T06:47:18",
  "op": [
    "vote",
    {
      "voter": "laissez-faire",
      "author": "totalrehash",
      "permlink": "videostevequaylealienagendanephiliminterdimensionalportalsantarcticweathercontrolstations-16lczlla2t",
      "weight": 10000
    }
  ]
}
2019/09/13 06:41:39
voteranomaly
authortotalrehash
permlinkelectriccarsandthegreenenergymyth-22p5u3fkb6
weight100 (1.00%)
Transaction InfoBlock #36378520/Trx ce40d2ba69bd94dc37426ecfbc20db7396300237
View Raw JSON Data
{
  "trx_id": "ce40d2ba69bd94dc37426ecfbc20db7396300237",
  "block": 36378520,
  "trx_in_block": 24,
  "op_in_trx": 0,
  "virtual_op": 0,
  "timestamp": "2019-09-13T06:41:39",
  "op": [
    "vote",
    {
      "voter": "anomaly",
      "author": "totalrehash",
      "permlink": "electriccarsandthegreenenergymyth-22p5u3fkb6",
      "weight": 100
    }
  ]
}

Account Metadata

POSTING JSON METADATA
profile{"profile_image":"https://cdn.steemitimages.com/DQmNT6TKB7zV8o6XeQvZWewGWYGgbnNNUBRYUMfzrT1MviJ/75HdOEyZ_400x400.jpg"}
JSON METADATA
profile{"profile_image":"https://cdn.steemitimages.com/DQmNT6TKB7zV8o6XeQvZWewGWYGgbnNNUBRYUMfzrT1MviJ/75HdOEyZ_400x400.jpg"}
{
  "posting_json_metadata": {
    "profile": {
      "profile_image": "https://cdn.steemitimages.com/DQmNT6TKB7zV8o6XeQvZWewGWYGgbnNNUBRYUMfzrT1MviJ/75HdOEyZ_400x400.jpg"
    }
  },
  "json_metadata": {
    "profile": {
      "profile_image": "https://cdn.steemitimages.com/DQmNT6TKB7zV8o6XeQvZWewGWYGgbnNNUBRYUMfzrT1MviJ/75HdOEyZ_400x400.jpg"
    }
  }
}

Auth Keys

Owner
Single Signature
Public Keys
STM7AF3829Weqe6kmQA38ZybvratQSF1F4uWxU18i3wWk8HEqQBX31/1
Active
Single Signature
Public Keys
STM8XCAWpp3Vz8GwsnM2WzPTwxaMqG8TdVGRcMpkMBhdwJKC23z5r1/1
Posting
Single Signature
Public Keys
STM5cqV9FuVStYBmeGtjdofyjopdbeimMSVrTJ6K5K3Jw3ivdrNAk1/1
Memo
STM7JkprcGqAcrXgZE8gaKYVgbJ36aN47a1rTEx2N4noMCmTxkQEf
{
  "owner": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM7AF3829Weqe6kmQA38ZybvratQSF1F4uWxU18i3wWk8HEqQBX3",
        1
      ]
    ]
  },
  "active": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM8XCAWpp3Vz8GwsnM2WzPTwxaMqG8TdVGRcMpkMBhdwJKC23z5r",
        1
      ]
    ]
  },
  "posting": {
    "weight_threshold": 1,
    "account_auths": [],
    "key_auths": [
      [
        "STM5cqV9FuVStYBmeGtjdofyjopdbeimMSVrTJ6K5K3Jw3ivdrNAk",
        1
      ]
    ]
  },
  "memo": "STM7JkprcGqAcrXgZE8gaKYVgbJ36aN47a1rTEx2N4noMCmTxkQEf"
}

Witness Votes

0 / 30
No active witness votes.
[]